KEGG   Cupriavidus taiwanensis: RALTA_A2900Help
Entry
RALTA_A2900       CDS       T00702                                 

Gene name
mrcA
Definition
(GenBank) bifunctional penicillin-binding protein 1a: transglycosylase (N-terminal); transpeptidase (C-terminal)
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00550  Peptidoglycan biosynthesis
cti01100  Metabolic pathways
cti01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RALTA_A2900 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RALTA_A2900 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cti01003]
    RALTA_A2900 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cti01011]
    RALTA_A2900 (mrcA)
Enzymes [BR:cti01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     RALTA_A2900 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RALTA_A2900 (mrcA)
Glycosyltransferases [BR:cti01003]
 Polysaccharide
  Bacterial polysaccharide
   RALTA_A2900 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:cti01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   RALTA_A2900 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: CAQ70825
UniProt: B3R7C5
LinkDB All DBs
Position
1:3073114..3075489
Genome map
AA seq 791 aa AA seqDB search
MATAQHKPPHPARRSIWTRLMFWAVGLVVAGAVVLALLLGYALLVAAPNLPSLDTITDYR
PKIPLRIYTADNVLIGEFGEERRNFVPIAEIPDVMKKAVLAIEDDRFYEHGGVDFVGVMR
AGLANLRGGLSQGASTITMQVARNFFLSSEKTYTRKIYEMLLAYKIEANLSKDQILELYM
NQIYLGQRAYGFDSAARVYFGKSVRDVTPAEAAMLAGLPKAPSAYNPVVNPRRAKVRQEY
ILQRMRDLRYITPEQYEEAVHAELKVRTEGNEFSTHAEYVAEIVRQLMYAQYREETYTRG
LTVYTTLTKTDQDAAYEAVRAGIMNYERKHGYRGPEAFIDLPSDPGEREQAIDDALVEHP
GSGDLRSAVVTSVSPKQVKATLLSGEVATIEGAALRFIAPSLSANAQPKMKMRPGAVIRV
TQDEKNNWSVTQLPEVAAAFVSINPQDGEIRSMVGGFDFNRNKFNRVTQAWRQPGSSFKP
FIYSAALEKGFSPATVINDAPLTIGPDTGGQVWEPKNYDGRFEGPMTMRRALAKSKNLVS
VRILRAIGTQYAQDYITRFGFEADKHPAYLPMALGSGAVTPLQMAGAYSVFANGGYRVNP
YLIQKVVDARGNVISETRPQRAGTDAVRVLDARTAFIADTMLRDVVRYGTANSAKQRLGR
NDLAGKTGTTNDAVDAWFAGYTPNLVAIAWMGYDQPKSLGVRETGGGLALPIWVSYMSKA
LKGVPESPERPAPEGVLMVGGDWTFEENAGGAGVASVGLGDPWPGKPEESTNPPADTEQE
KRKILEMFGGA
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcacaacacaagccgccccaccctgcccgccgttcgatctggacgcggctc
atgttctgggcggtcggactggttgtcgccggtgccgtcgtgcttgcgctgctgctgggc
tacgcgctgctggtggccgcgcccaacctgccttcgctggacaccatcaccgactaccgg
cccaagatcccgctgcggatctacaccgccgacaatgtgctgatcggcgaattcggcgag
gagcggcgcaacttcgtgcccatcgccgaaattccggacgtgatgaaaaaggcagtgctg
gcgatcgaggacgaccgcttctacgagcacggcggcgtcgatttcgtcggcgtcatgcgt
gccggcctggccaacctgcgcggcgggctgtcgcagggcgcctccaccatcaccatgcag
gtggcgcgcaacttcttcctgtccagcgagaagacctacacccgcaagatctacgagatg
ctgctggcgtacaagatcgaggccaacctgagcaaggaccagatcctcgagctgtacatg
aaccagatctacctgggccagcgcgcctacggcttcgacagcgccgcgcgcgtctacttc
ggcaagtcggtgcgcgatgtgacaccggccgaagcggcgatgctggccgggttgccgaag
gcgccgtcggcctacaacccggtggtcaatccgcgccgcgccaaggtgcgccaggagtac
atcctgcaacgcatgcgcgacctgcgctacatcacccccgagcagtatgaggaggccgtg
cacgcggagctgaaggtgcgcaccgagggcaacgagttctccacgcacgccgaatacgtg
gccgagatcgtgcgccagctcatgtacgcgcagtaccgcgaggaaacctacacgcgcggc
ctgacggtctacaccacgctgaccaagaccgaccaggacgccgcctatgaagccgtgcgc
gccggcatcatgaactacgagcgcaagcacggctaccgcggtcccgaagcctttatcgac
ctgccttccgaccccggcgagcgcgagcaggccatcgacgatgcgctggtcgagcatccg
ggcagcggcgacctgcgctcggcggtggtcaccagcgtgtcgcccaagcaggtcaaggcg
acgctgctgtccggcgaagtggcgaccatcgaaggcgcggcgctgcgctttatcgcgccg
tcgctgtcggccaacgcgcagcccaagatgaagatgcgccccggcgcggtgattcgcgtg
acgcaggacgagaagaacaactggtcggtgacgcagctgccggaagtggccgcggcgttc
gtgtcgatcaacccgcaggatggcgagatccgctcgatggtgggcggcttcgacttcaac
cgcaacaagttcaaccgcgtgacccaggcctggcggcagcctgggtccagcttcaagcct
ttcatctactcggctgcgctggaaaagggcttctccccggccacggtgatcaatgacgcg
ccgctgacgatcggccccgataccggcggccaggtgtgggaacccaagaactacgacggc
cgcttcgagggcccgatgaccatgcgccgcgcgctggccaagtccaagaacctggtttcg
gtgcggatcctgcgcgcgatcggcacgcagtacgcgcaggactacatcacccgcttcggc
ttcgaggcagacaagcatccggcctacctgccgatggcgctgggctcgggcgcggtgacg
ccgctgcagatggccggtgcctattcggtatttgccaacggcggctaccgcgtcaacccc
tacctgatccagaaggtggtcgatgcgcgcggcaacgtgatctctgaaacccgtccgcaa
cgcgccggcaccgacgccgtgcgggtgctcgacgcgcgcacggcctttatcgccgacacc
atgctgcgcgacgtggtccgctacggcacggccaacagcgccaagcagcgcctgggccgc
aatgacctggccggcaagaccggcaccaccaacgacgcggtcgatgcctggttcgccggc
tacacccccaacctggtagcgatcgcctggatgggctacgaccagcccaagagcctgggc
gtgcgcgaaaccggcggcggcctggccctgccgatctgggtcagctacatgagcaaggca
ctcaagggcgtgccggagtcgccggaacggcccgcgcccgagggcgtgctgatggtgggc
ggcgactggaccttcgaagaaaacgccggcggcgccggcgtggcgtcggtgggcctgggc
gatccgtggccgggcaagccggaggaatcgacaaacccgccggccgataccgagcaagag
aaacgcaagatcctcgagatgttcggcggcgcctaa

DBGET integrated database retrieval system