KEGG   Cupriavidus taiwanensis: RALTA_A2952Help
Entry
RALTA_A2952       CDS       T00702                                 

Gene name
tufB1
Definition
(GenBank) protein chain elongation factor EF-Tu
  KO
K02358  elongation factor Tu
Organism
cti  Cupriavidus taiwanensis
Brite
KEGG Orthology (KO) [BR:cti00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cti03012]
    RALTA_A2952 (tufB1)
   03029 Mitochondrial biogenesis [BR:cti03029]
    RALTA_A2952 (tufB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cti04147]
    RALTA_A2952 (tufB1)
Translation factors [BR:cti03012]
 Eukaryotic Type
  Elongation factors
   RALTA_A2952 (tufB1)
 Prokaryotic Type
   RALTA_A2952 (tufB1)
Mitochondrial biogenesis [BR:cti03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RALTA_A2952 (tufB1)
Exosome [BR:cti04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RALTA_A2952 (tufB1)
  Exosomal proteins of breast cancer cells
   RALTA_A2952 (tufB1)
  Exosomal proteins of colorectal cancer cells
   RALTA_A2952 (tufB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: CAQ70875
UniProt: B3R7T0
LinkDB All DBs
Position
1:complement(3112208..3113398)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLASKFGGAAKKYDEIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDTPIIKGSAKLALE
GDKGDLGEEAIMRLADALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGRIERGVIK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGLLLRGTKREDVERGQVLCKPGS
IKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKILD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaaagttcgagcggaccaagccgcacgtgaacgttggtacgattggtcac
gttgaccacggcaagaccacgctgaccgcagcgatcgccacggtgctggcttcgaagttc
ggcggtgccgccaagaagtacgacgaaatcgacgcagcgccggaagaaaaggcacgcggc
attaccatcaacaccgcgcacgtcgagtacgagacggccaaccgccactacgcgcacgtt
gactgcccgggccacgccgactacgtgaagaacatgatcacgggtgccgcccagatggac
ggcgcgatcctggtgtgctcggccgctgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgtcaggttggcgtgccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgccgaactgctcgagctggtcgagatggaagttcgcgagctgctgagcaag
tacgagttccccggcgacgacaccccgatcatcaagggttcggccaagctggcgctggaa
ggcgacaagggcgacctgggcgaagaagccatcatgcgcctggccgacgcgctggacacc
tacatcccgacgccggagcgtgccgttgacggtaccttcctgatgccggtggaagacgtg
ttctcgatctcgggtcgcggcaccgtggtgaccggccgtatcgagcgcggcgtgatcaag
gtcggcgaggaaatcgaaatcgtcggtatcaagccgaccgtgaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtcggtctgctg
ctgcgcggcaccaagcgtgaagacgtcgagcgcggccaggtgctgtgcaagccgggttcg
atcaagccgcacacccacttcaccggcgaggtgtacatcctgtcgaaggacgaaggcggc
cgtcacaccccgttcttcaacaactaccgcccgcagttctacttccgtaccaccgacgtg
accggctcgatcgagctgccgaaggacaaggaaatggtcatgccgggtgacaacgtgtcg
atcaccgtcaagctgatcgccccgatcgccatggaagaaggcctgcgcttcgctatccgc
gaaggtggccgtaccgtcggcgccggcgtcgtggcaaagatcctcgactaa

DBGET integrated database retrieval system