KEGG   Cupriavidus taiwanensis: RALTA_B1630Help
Entry
RALTA_B1630       CDS       T00702                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP] (Oxalosuccinate decarboxylase) (IDH)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00020  Citrate cycle (TCA cycle)
cti00480  Glutathione metabolism
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01130  Biosynthesis of antibiotics
cti01200  Carbon metabolism
cti01210  2-Oxocarboxylic acid metabolism
cti01230  Biosynthesis of amino acids
Module
cti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cti_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RALTA_B1630 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RALTA_B1630 (icd)
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RALTA_B1630 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH TROVE
Motif
Other DBs
NCBI-ProteinID: CAQ72225
UniProt: B3RBF0
LinkDB All DBs
Position
2:complement(1754155..1756392)
Genome map
AA seq 745 aa AA seqDB search
MSTQQPTIIYTLTDEAPLLATSAFLPIIQTFTKPAGINVTTSDISVAGRILGEFPDFLTE
EQRVPDNLAELGKLTQLPDTNIIKLPNISASVHQLVSAIRELQGKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPAAVKNYARKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTLDRARDVKMELITKSGKTIVLKPKVSLQDGEIIDSMFMSKKALCAFYEE
QFEDARKTGVMLSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHGALFDELGVNVNNGLV
NLYEKIESLPSSKREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
IGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGNFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIAEDGVANIVDLATGEVLLTQNVEQGDIWRMCQVKDAPIRDWVKLAVTRA
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDHDTSGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALAVSLEDVGIKTGNARAKILAKTLDAATGKLLDNNKSPSPKTGELDNR
GSQFYLAMYWAQELAAQSDDAELAAKFAPLARTLTDNEQKIVGELAAVQGQPVDIGGYYQ
PDAAKLSAAMRPSQTLNAALASVAA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagtacccagcaacccaccatcatctacacgctgaccgacgaagccccgctgctggcg
accagtgcgttcctcccgatcatccagaccttcaccaagccggccggcatcaacgtgacc
accagtgatatctcggtggctggccgtatcctgggtgagttccccgacttcctgaccgaa
gaacagcgcgtgccggacaacctggccgagctgggcaagctgacgcagctgccggacacc
aacatcatcaagctgccgaacatctcggcctcggtgcaccaactggtcagcgccatccgc
gaactgcagggcaagggctacaaggtgcccgactacccggaagacccgaagaccgacgaa
gaaaaggcgatccagaagcgctattccaagtgcctgggctcggccgtgaacccggtcctg
cgcgaaggcaactccgaccgccgtgcccccgccgcggtcaagaactacgcgcgcaagcac
ccgcacagcatgggcgagtggagcatggcctcgcgcacgcacgtggcgcacatgaagcac
ggcgacttctatcacggcgaaaagtcgatgacgctggaccgcgcgcgcgacgtcaagatg
gagctgatcaccaagagcggcaagaccatcgtgctcaagcccaaggtgtcgctgcaggac
ggcgagatcatcgacagcatgttcatgagcaagaaggccctgtgcgccttctatgaagag
cagttcgaagacgcgcgcaagaccggcgtgatgctgtcgctgcacgtcaaggcgaccatg
atgaaggtgtcgcacccgatcgtgttcggccacgccgtcaagattttctacaaggaagcg
ttcgccaagcacggcgcgctgttcgacgaactgggcgtcaatgtcaacaacggcctggtc
aacctgtacgagaagatcgagtcgctgcccagctccaagcgcgaagagatcatccgcgac
ctgcacgcctgccacgagcatcgcccggaactggcaatggtggactcggccaagggcatc
tcgaacctgcacgcgccgaacgacgtgatcgtcgatgcctcgatgccggccatgatccgc
atcggcggcaagatgtggggcgccgacggccgtccgaaggacaccaaggccgtgatcccg
gagagcacctttgcccggatctaccaggagatcatcaacttctgcaagaccaacggcaac
ttcgacccgaccaccatgggcaccgtgcccaacgtgggcctgatggcgcagaaggcggaa
gagtacggctcgcacgacaagaccttcgagatcgccgaagacggcgtcgccaacatcgtc
gacctggccaccggtgaggtgctgctgacgcagaacgtcgagcagggcgacatctggcgc
atgtgccaggtcaaggacgcgccgatccgcgactgggtcaagctggctgtcacgcgcgcg
cgcaactcgggcatgccggcggtgttctggctggacccgtaccgtccgcacgaggccgag
ctgatcaagaaggtagaaacgtacctgaaggaccacgacaccagcggcctggacatccag
atcatgtcgcaggtgcgcgccatgcgctacacgctggaacgcgtgatccgcggcctggac
accatctcggtgaccggcaacatcctgcgcgactacctgaccgacctgttcccgatcatg
gagctgggcaccagcgccaagatgctgtcgatcgtgccgctgatggccggcggcggcatg
tatgaaacgggtgccggcggctcggcgccgaagcacgtcaagcaactggtggaggaaaac
cacctgcgctgggattcgctgggcgagttcctggcgctggcggtgtcgctggaagacgtt
ggcatcaagaccggcaatgcccgcgccaagatcctggccaagacgctggatgccgccacc
ggcaagctgctcgacaacaacaagagcccgtcgccgaagaccggcgagctggataaccgc
ggcagccagttctacctggcgatgtactgggcccaggaactggccgcgcagtcggacgac
gcggaactggccgccaagttcgcgccgctggccaggacgctgaccgacaacgagcagaag
atcgttggcgaactcgccgcggtgcaaggccagccggtggacatcggcggctactaccag
ccggacgccgccaagctcagcgccgcgatgcgcccgagccagacgctgaacgccgcgctg
gcctcggtggcagcctga

DBGET integrated database retrieval system