KEGG   Cupriavidus taiwanensis: RALTA_B1661Help
Entry
RALTA_B1661       CDS       T00702                                 

Gene name
acoD
Definition
(GenBank) Acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00010  Glycolysis / Gluconeogenesis
cti00620  Pyruvate metabolism
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RALTA_B1661 (acoD)
   00620 Pyruvate metabolism
    RALTA_B1661 (acoD)
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     RALTA_B1661 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: CAQ72255
UniProt: B3RBI0
LinkDB All DBs
Position
2:1789601..1791115
Genome map
AA seq 504 aa AA seqDB search
MAEIAQLGVSNPYKQQYDNYIGGQWVPPAGGEYFESITPITGKPFTRVPRSNQQDVDAAL
DAAHAAKAAWARTSTTERANILNRIADRIEANLKLLAVAESIDNGKPVRETTAADLPLAV
DHFRYFAGCIRAQEGGISEIDGDTIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAAG
NCVVLKPAEQTPASILVLMEVIGDLLPPGVVNVINGFGLEAGKPLASSPRISKVAFTGET
TTGRLIMQYASQNLIPVTLELGGKSPNIFFEDVLAADDAFFDKALEGFAMFALNQGEVCT
CPSRALIQESIYDRFMERALKRVAAIRQGHPLDTGTMIGAQASAEQLEKILSYIDLGRKE
GAQCLSGGERNVLDGDLSGGYYVKPTVFAGHNKMRIFQEEIFGPVVSVTTFKDEEEALAI
ANDTLYGLGAGVWTRDGARAFRMGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENHR
MMLDHYQQTKNLLVSYSPNALGFF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatcgcccagctgggcgtcagcaacccctacaagcagcagtacgacaactac
attggcggccagtgggtgccgcccgccgggggcgagtacttcgagtccatcacgccgatc
accggcaagccgttcacgcgcgtgccgcgctcgaaccagcaggacgtcgacgccgcgctg
gatgccgcgcacgccgccaaggccgcgtgggcgcgcacctcgaccaccgagcgcgccaat
atcctgaaccgcatcgccgaccgcatcgaggccaacctgaagctgctggcggtggctgag
agcatcgacaacggcaagccggtgcgcgagaccaccgccgccgacctgccgctggcggtg
gaccacttccgctacttcgcgggctgcatccgcgcgcaggagggcggcatttccgagatc
gacggcgacaccatcgcctaccacttccatgagccgctgggcgtggtcggccagatcatc
ccgtggaacttcccgctgctgatggccacctggaagctggccccggcgcttgccgccggc
aactgcgtggtgctgaagcccgccgagcagacgcctgcctcgatcctggtgctgatggaa
gtcatcggcgacctgctgccgccgggcgtggtcaacgtgatcaacggcttcggcctggaa
gccggcaagccgctggcgtcgagcccgcgcatcagcaaggtggcattcaccggcgagacc
accactggccggctgatcatgcagtacgcctcgcagaacctgatcccggtcacgctggaa
ctgggcggcaagtcgcccaacatcttcttcgaggacgtgctcgccgccgacgacgccttc
ttcgacaaggcactggaaggctttgccatgttcgcgctgaaccagggcgaggtctgcacc
tgcccgtcgcgcgcgctgatccaggagtcgatctatgaccgcttcatggaacgcgcgctc
aagcgcgtcgccgcgatccgccagggccatccgctcgacaccggcaccatgatcggcgcg
caggcatcggccgaacagctggagaagatcctgtcgtacatcgacctgggccgcaaggaa
ggcgcgcagtgcctcagcggcggcgaacgcaacgtgctggacggcgacctgtccggcggc
tactacgtcaagccgaccgtcttcgccggacacaacaagatgcgcatcttccaggaagag
atcttcgggccggtggtctcggtcaccaccttcaaggacgaggaagaggcgctcgccatc
gccaacgacacgctctacggccttggcgcaggggtctggacgcgcgacggcgcgcgcgcg
ttccgcatgggccgcggcatccaggccggccgcgtgtggaccaactgctaccacgcctac
ccggcgcatgccgcgttcggcggctacaagcagtccggcatcggccgcgagaaccatcgc
atgatgcttgaccactaccagcagaccaagaacctgctggtgagctacagccccaacgcg
ctggggttcttctga

DBGET integrated database retrieval system