KEGG   Cupriavidus taiwanensis: RALTA_B1702Help
Entry
RALTA_B1702       CDS       T00702                                 

Gene name
cbbL
Definition
(GenBank) Ribulose bisphosphate carboxylase (RuBisCO), large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00630  Glyoxylate and dicarboxylate metabolism
cti00710  Carbon fixation in photosynthetic organisms
cti01100  Metabolic pathways
cti01120  Microbial metabolism in diverse environments
cti01200  Carbon metabolism
Module
cti_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cti_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    RALTA_B1702 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RALTA_B1702 (cbbL)
Enzymes [BR:cti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     RALTA_B1702 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: CAQ72293
UniProt: B3RBL8
LinkDB All DBs
Position
2:complement(1830904..1832364)
Genome map
AA seq 486 aa AA seqDB search
MNAPEPVQGKPRKRYDAGVMKYKEMGYWDADYEPKDTDLLALFRITPQDGVDPVEAAAAV
AGESSTATWTVVWTDRLTACDMYRAKAYRVDPVPNNPEQFFCYVAYDLSLFEEGSIANLT
ASIIGNVFSFKPIKAARLEDMRFPVAYVKTFAGPSTGIIVERERLDKFGRPLLGATTKPK
LGLSGRNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLFVMDAVNKASAATGEVKG
SYLNVTAGTMEEMYRRAEFAKSLGSVIIMVDLIVGWTCIQSMSNWCRQNDMILHLHRAGH
GTYTRQKNHGVSFRVIAKWLRLAGVDHMHTGTAVGKLEGDPLTVQGYYNVCRDAYTRTDL
TRGLFFDQDWASLRKVMPVASGGIHAGQMHQLISLFGDDVVLQFGGGTIGHPQGIQAGAT
ANRVALEAMVLARNEGRDILNEGPEILRDAARWCGPLRAALDTWGDITFNYTPTDTSDFV
PTASVA
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacccgaaccggtccaaggcaagccgcgcaagcgctatgacgccggcgtcatg
aagtacaaggaaatggggtactgggacgcggactacgagcccaaggacaccgacctgctg
gcgctgttccgcatcacgccgcaggatggcgtggacccggtcgaggccgccgccgcggtg
gccggcgaatcctccaccgccacctggacggtggtgtggaccgaccgcctgaccgcgtgc
gacatgtaccgcgccaaggcctaccgcgtcgatccggtgccgaacaacccggagcagttc
ttctgctacgtggcctatgacctgtcgctgttcgaggaaggctcgatcgccaacctgacc
gcgtcgatcatcggcaacgtgttcagcttcaagccgatcaaggcggcgcggctggaagac
atgcgcttcccggtggcctatgtgaagaccttcgccggcccgtcgaccggcatcattgtc
gagcgcgagcgtctggacaagttcggccgcccgctgctgggcgccaccaccaagcccaag
ctcggcctgtcgggccgcaactacggccgcgtggtgtatgaggggctgaaaggcggcctg
gacttcatgaaggacgacgagaacatcaactcgcagccgttcatgcactggcgcgaccgc
ttcctgttcgtgatggacgcggtcaacaaggcctcggccgccaccggcgaggtcaagggc
agctacctcaacgtgaccgccggcaccatggaagagatgtaccggcgcgcggagttcgcc
aagtcgctgggctcggtcatcatcatggtcgacctgatcgtgggctggacctgcatccag
tcgatgagcaactggtgccgccagaacgacatgatcctgcacctgcaccgcgcgggccac
ggcacctacacgcgccagaagaaccacggcgtgtcgttccgcgtgatcgccaagtggctg
cgcctggccggcgtggaccacatgcacaccggcaccgcggtgggcaaactcgaaggcgat
ccgctgaccgtgcagggctactacaacgtctgccgcgatgcctacacccgtaccgacctg
acccgcgggctgttcttcgaccaggactgggcctcgctgcgcaaggtgatgccggtggcc
tcgggcggcatccacgccggccagatgcaccagctgatcagcctgttcggcgacgacgtg
gtgctgcagttcggcggcggcaccatcggccacccgcaagggatccaggccggcgccacc
gccaaccgggtcgcgctggaggcaatggtgctggcgcgcaacgaggggcgcgacatcctc
aacgaagggccggagatcctgcgcgatgccgcgcgctggtgcgggccgctgcgcgccgcg
ctcgatacctggggcgacatcaccttcaactacacgccgaccgatacctcggacttcgtg
cccaccgcctcggtggcctga

DBGET integrated database retrieval system