KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0542Help
Entry
CTLon_0542        CDS       T00646                                 

Gene name
sodM
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Brite
Enzymes [BR:ctl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTLon_0542 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3
Motif
Other DBs
NCBI-ProteinID: CAP06940
LinkDB All DBs
Position
complement(645929..646549)
Genome map
AA seq 206 aa AA seqDB search
MVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKSLDVANATQDLTR
LIAINPALRFNGGGHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFWGSFDSFLKNFIA
SSAAVQGSGWGWLAFCPKKQELVVQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKNVR
IDYLKSFPSIINWDYIENRFVEMSKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcttcttatatgcttcccgcattgccttatgattacgatgctttagagcct
gtaattagtgctgagattatgcaactgcatcatcaaaagcatcaccaaggatatataaat
aatttgaatgaggccttaaaaagtttagatgtagcaaacgctactcaagatttaacaagg
ctaatcgcaatcaatcctgctctgcgtttcaatggtggagggcatattaaccactctctt
ttctgggagatgcttgcgcctcaagggaaaggagggggagttcctcctcgtcatgaatta
ctaaaattaatcgaaaaattctggggctctttcgatagttttttaaaaaattttattgct
tcttctgctgcagtgcaaggatctggctggggatggttagctttttgtcccaaaaaacaa
gagcttgtggtacagaccacagcaaaccaggatcctctagaggcgacgaccgggatgatc
cctctcctaggagtagatgtgtgggagcacgcatattatctccagtataaaaatgtgaga
atagattatctaaaaagtttcccgagcataattaattgggattatatagagaatcgcttt
gtagaaatgagcaagcaataa

DBGET integrated database retrieval system