KEGG   Chlamydia trachomatis L2b/Canada1: L2BCAN1_00812Help
Entry
L2BCAN1_00812     CDS       T02567                                 

Definition
(GenBank) bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ctlc  Chlamydia trachomatis L2b/Canada1
Pathway
ctlc00471  D-Glutamine and D-glutamate metabolism
ctlc00550  Peptidoglycan biosynthesis
ctlc01100  Metabolic pathways
ctlc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ctlc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    L2BCAN1_00812
   00473 D-Alanine metabolism
    L2BCAN1_00812
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    L2BCAN1_00812
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    L2BCAN1_00812
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctlc01011]
    L2BCAN1_00812
Enzymes [BR:ctlc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     L2BCAN1_00812
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     L2BCAN1_00812
Peptidoglycan biosynthesis and degradation proteins [BR:ctlc01011]
 Precursor biosynthesis
  Amino acid ligase
   L2BCAN1_00812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_C Mur_ligase_M CPSase_L_D2 ATP-grasp GARS_A ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CCP92653
LinkDB All DBs
Position
891719..894127
Genome map
AA seq 802 aa AA seqDB search
MKSLFYHFIGIGGIGMSALAHVLLDRGYSVSGSDLSEGKVVEKLKNKGAEFFLGNQEEHI
PEGAVVVYSSSISKENPEFLSAKSRGNRVVHRAELLAELAQDQISIFVTGSHGKTTVSSL
ITAILQEAKKNPSFAIGGLNQEGINGGSGSEYFVAEADESDGSIRCYTPEFSVITNIDDE
HLSNFEGDRELLLASLKDFALKTQQICWYNGDCPRLRSCLQGHTFGLDSSCDLHILSYYQ
EGWRLYFTAKYQDVVYADIEVQLVGMHNVLNAAAAMGIALSLGIDEGAIRNAFRGFSGVQ
RRLQRKNSSETFLFLEDYAHHPSEISCTLRAVRTAVGQRRILAICQPHRFSRLRECIDSF
PSAFKDADEVLLTEVYSAGEEAEDISYQELAEAISQESIVKCTHIPFHELQRHLEQSIRV
HDVCVSLGAGNIVNLGEKLRDFEPQKLHLGIICGGKSCEHEISVLSAKNIAKHLSKSFYD
VSYFLITREGLWESVSSLETAEDSGKSVFDPEIAQRLEKVDVVLPILHGPYGEDGAMQGF
LETIGKPYTGPAIAFSAIAMNKVFTKRFMSDLGIPVVPYLPLTLAGWKQEQDKWLAHIVE
AFSFPMFVKSSHLGSSIGVFEVHNVIELRDAINEAFMRDNDVFVEENRLGCKEIEVSVLG
DGSGAFVIAGLHERRGSGGFIDYQEKYGLSGKSSAQIVFDTDLSKEIQEQILEAADKIYR
LLLGKGSCRIDFFVDEEGNFWLSEMNPIPGMTETSPFLTSFIRKGWSYEQIVHQLVIDGL
QRFNQRQRLISTSFVDQAFAIQ
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttgttttaccactttattggtattggtgggattggaatgagtgctttagca
catgttctgctcgatcgaggatatagcgtatcgggaagtgatctttccgaggggaaagtg
gtagagaagctgaagaataaaggagcggaattctttttagggaatcaagaagaacatatc
cctgaaggcgctgtagttgtatacagttcaagtatttctaaagaaaatcctgaattttta
tcagctaaaagtagagggaaccgtgtagttcatcgagccgaattattagccgagcttgct
caagatcagatttctatttttgttacaggaagtcatgggaagacaacagtctcttctttg
atcacagccattttgcaggaagcaaagaaaaatccgtcctttgctataggaggtttgaat
caagaaggcatcaatggtggttcgggatctgaatattttgttgctgaagcagatgaaagc
gatgggtctattcggtgttatactccagagttttctgttattacgaatatagatgatgag
catctgtctaattttgaaggagatcgagagcttcttctggcttctttgaaagactttgca
ctcaagactcagcagatctgttggtataatggagattgtcctcgcttgcgttcatgcttg
caagggcatacttttggattggactcttcttgtgatctacatattctatcttattatcaa
gaaggatggagactgtactttacagcaaagtatcaagatgtagtgtatgcagatatagaa
gtgcaattggtcggcatgcataacgttttgaatgctgcagcagctatgggaatagctctg
tcattgggtatagatgaaggtgctataagaaatgctttcagagggttttcaggagttcaa
agacgattacaaagaaagaattcttctgagacctttctctttttagaagattatgcacac
catccttcagagatttcttgtacattacgtgctgttcgtactgctgttggacagagacgt
attttagctatttgccagcctcatcgtttttctcgattaagagagtgtatagacagcttc
ccgtcagcatttaaagatgctgatgaagtcttgttaacagaagtgtacagtgcgggagag
gaggcggaagatatctcgtaccaagagcttgctgaagctattagtcaagagtcgatagta
aagtgtacgcatattccgtttcatgagttgcagagacatttagagcagtccatccgtgta
cacgatgtgtgtgtatctttaggtgctggtaatattgtgaatttgggagaaaagttaaga
gattttgagcctcaaaaactgcacttaggaattatttgtggagggaaatcatgcgaacac
gagatttccgttctatctgcaaaaaatatagctaaacatctttcaaaatccttttatgat
gtgagttattttttaattactcgagaaggattatgggagagcgtctcttcattagagact
gctgaagactcagggaaatccgtttttgatccagaaatagctcagagactagaaaaagta
gacgtagtgttgccgatactacatggtccctatggtgaagatggagctatgcaaggattt
ctagagactattggtaagccttatacaggtcctgctatcgctttttctgcgatagcaatg
aataaagtgtttactaagcgctttatgagtgatttagggattcctgtcgttccttatctc
cctttaacattagcaggatggaagcaagaacaagataagtggttagcacatattgtagag
gctttttcatttcctatgtttgtgaaatcttcgcatttaggatctagtatcggcgtcttc
gaagttcataatgttatagaattacgagatgccattaatgaagcttttatgcgagataac
gacgtgtttgtagaagaaaatcgcttaggttgcaaagaaatagaagtttctgtcttagga
gatggatctggtgcgtttgtcattgctggtctgcatgagcgtcgtgggagtggaggtttt
atagactatcaagagaagtatgggttaagtggcaagtctagtgcgcagatcgtatttgat
acagatctctctaaagaaatacaggaacaaatactagaagctgcggataaaatttaccgt
ttattgctagggaaagggtcgtgtcgtattgacttttttgtagatgaagaaggaaatttc
tggttatctgagatgaaccccattcctggaatgacagaaacgagcccatttcttacatct
ttcattcgtaaagggtggagttatgaacagatagtccatcaacttgttattgatgggctg
caacgatttaaccaacgccaacgcttgatatcaacgtcttttgtagatcaagcgttcgct
attcagtaa

DBGET integrated database retrieval system