KEGG   Chlamydia trachomatis L2/434/Bu(f): CTLFINAL_00705Help
Entry
CTLFINAL_00705    CDS       T02621                                 

Definition
(GenBank) D-alanyl-alanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
ctlf  Chlamydia trachomatis L2/434/Bu(f)
Pathway
ctlf00471  D-Glutamine and D-glutamate metabolism
ctlf00550  Peptidoglycan biosynthesis
ctlf01100  Metabolic pathways
ctlf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ctlf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CTLFINAL_00705
   00473 D-Alanine metabolism
    CTLFINAL_00705
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTLFINAL_00705
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CTLFINAL_00705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctlf01011]
    CTLFINAL_00705
Enzymes [BR:ctlf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CTLFINAL_00705
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     CTLFINAL_00705
Peptidoglycan biosynthesis and degradation proteins [BR:ctlf01011]
 Precursor biosynthesis
  Amino acid ligase
   CTLFINAL_00705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_C Mur_ligase_M CPSase_L_D2 ATP-grasp GARS_A ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AGJ65162
LinkDB All DBs
Position
174777..177206
Genome map
AA seq 809 aa AA seqDB search
MNLYRLMMKSLFYHFIGIGGIGMSALAHVLLDRGYSVSGSDLSEGKVVEKLKNKGAEFFL
GNQEEHIPEGAVVVYSSSISKENPEFLSAKSRGNRVVHRAELLAELAQDQISIFVTGSHG
KTTVSSLITAILQEAKKNPSFAIGGLNQEGINGGSGSEYFVAEADESDGSIRCYTPEFSV
ITNIDDEHLSNFEGDRELLLASLKDFALKTQQICWYNGDCPRLRSCLQGHTFGLDSSCDL
HILSYYQEGWRLYFTAKYQDVVYADIEVQLVGMHNVLNAAAAMGIALSLGIDEGAIRNAF
RGFSGVQRRLQRKNSSETFLFLEDYAHHPSEISCTLRAVRTAVGQRRILAICQPHRFSRL
RECIDSFPSAFKDADEVLLTEVYSAGEEAEDISYQELAEAISQESIVKCTHIPFHELQRH
LEQSIRVHDVCVSLGAGNIVNLGEKLRDFEPQKLHLGIICGGKSCEHEISVLSAKNIAKH
LSKSFYDVSYFLITREGLWESVSSLETAEDSGKSVFDPEIAQRLEKVDVVLPILHGPYGE
DGAMQGFLETIGKPYTGPAIAFSAIAMNKVFTKRFMSDLGIPVVPYLPLTLAGWKQEQDK
WLAHIVEAFSFPMFVKSSHLGSSIGVFEVHNVIELRDAINEAFMRDNDVFVEENRLGCKE
IEVSVLGDGSGAFVIAGLHERRGSGGFIDYQEKYGLSGKSSAQIVFDTDLSKEIQEQILE
AADKIYRLLLGKGSCRIDFFVDEEGNFWLSEMNPIPGMTETSPFLTSFIRKGWSYEQIVH
QLVIDGLQRFNQRQRLISTSFVDQAFAIQ
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctctataggctcatgatgaaaagcttgttttaccactttattggtattggtggg
attggaatgagtgctttagcacatgttctgctcgatcgaggatatagcgtatcgggaagt
gatctttccgaggggaaagtggtagagaagctgaagaataaaggagcggaattcttttta
gggaatcaagaagaacatatccctgaaggcgctgtagttgtatacagttcaagtatttct
aaagaaaatcctgaatttttatcagctaaaagtagagggaaccgtgtagttcatcgagcc
gaattattagccgagcttgctcaagatcagatttctatttttgttacaggaagtcatggg
aagacaacagtctcttctttgatcacagccattttgcaggaagcaaagaaaaatccgtcc
tttgctataggaggtttgaatcaagaaggcatcaatggtggttcgggatctgaatatttt
gttgctgaagcagatgaaagcgatgggtctattcggtgttatactccagagttttctgtt
attacgaatatagatgatgagcatctgtctaattttgaaggagatcgagagcttcttctg
gcttctttgaaagactttgcactcaagactcagcagatctgttggtataatggagattgt
cctcgcttgcgttcatgcttgcaagggcatacttttggattggactcttcttgtgatcta
catattctatcttattatcaagaaggatggagactgtactttacagcaaagtatcaagat
gtagtgtatgcagatatagaagtgcaattggtcggcatgcataacgttttgaatgctgca
gcagctatgggaatagctctgtcattgggtatagatgaaggtgctataagaaatgctttc
agagggttttcaggagttcaaagacgattacaaagaaagaattcttctgagacctttctc
tttttagaagattatgcacaccatccttcagagatttcttgtacattacgtgctgttcgt
actgctgttggacagagacgtattttagctatttgccagcctcatcgtttttctcgatta
agagagtgtatagacagcttcccgtcagcatttaaagatgctgatgaagtcttgttaaca
gaagtgtacagtgcgggagaggaggcggaagatatctcgtaccaagagcttgctgaagct
attagtcaagagtcgatagtaaagtgtacgcatattccgtttcatgagttgcagagacat
ttagagcagtccatccgtgtacacgatgtgtgtgtatctttaggtgctggtaatattgtg
aatttgggagaaaagttaagagattttgagcctcaaaaactgcacttaggaattatttgt
ggagggaaatcatgcgaacacgagatttccgttctatctgcaaaaaatatagctaaacat
ctttcaaaatccttttatgatgtgagttattttttaattactcgagaaggattatgggag
agcgtctcttcattagagactgctgaagactcagggaaatccgtttttgatccagaaata
gctcagagactagaaaaagtagacgtagtgttgccgatactacatggtccctatggtgaa
gatggagctatgcaaggatttctagagactattggtaagccttatacaggtcctgctatc
gctttttctgcgatagcaatgaataaagtgtttactaagcgctttatgagtgatttaggg
attcctgtcgttccttatctccctttaacattagcaggatggaagcaagaacaagataag
tggttagcacatattgtagaggctttttcatttcctatgtttgtgaaatcttcgcattta
ggatctagtatcggcgtcttcgaagttcataatgttatagaattacgagatgccattaat
gaagcttttatgcgagataacgacgtgtttgtagaagaaaatcgcttaggttgcaaagaa
atagaagtttctgtcttaggagatggatctggtgcgtttgtcattgctggtctgcatgag
cgtcgtgggagtggaggttttatagactatcaagagaagtatgggttaagtggcaagtct
agtgcgcagatcgtatttgatacagatctctctaaagaaatacaggaacaaatactagaa
gctgcggataaaatttaccgtttattgctagggaaagggtcgtgtcgtattgactttttt
gtagatgaagaaggaaatttctggttatctgagatgaaccccattcctggaatgacagaa
acgagcccatttcttacatctttcattcgtaaagggtggagttatgaacagatagtccat
caacttgttattgatgggctgcaacgatttaaccaacgccaacgcttgatatcaacgtct
tttgtagatcaagcgttcgctattcagtaa

DBGET integrated database retrieval system