KEGG   Chlamydia trachomatis L2/434/Bu(i): CTLINITIAL_02850Help
Entry
CTLINITIAL_02850  CDS       T02622                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ctli  Chlamydia trachomatis L2/434/Bu(i)
Brite
Enzymes [BR:ctli01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTLINITIAL_02850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C Imm3
Motif
Other DBs
NCBI-ProteinID: AGJ64649
LinkDB All DBs
Position
complement(645896..646522)
Genome map
AA seq 208 aa AA seqDB search
MAMVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKSLDVANATQDL
TRLIAINPALRFNGGGHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFWGSFDSFLKNF
IASSAAVQGSGWGWLAFCPKKQELVVQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKN
VRIDYLKSFPSIINWDYIENRFVEMSKQ
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctatggtcttttcttcttatatgcttcccgcattgccttatgattacgatgcttta
gagcctgtaattagtgctgagattatgcaactgcatcatcaaaagcatcaccaaggatat
ataaataatttgaatgaggccttaaaaagtttagatgtagcaaacgctactcaagattta
acaaggctaatcgcaatcaatcctgctctgcgtttcaatggtggagggcatattaaccac
tctcttttctgggagatgcttgcgcctcaagggaaaggagggggagttcctcctcgtcat
gaattactaaaattaatcgaaaaattctggggctctttcgatagttttttaaaaaatttt
attgcttcttctgctgcagtgcaaggatctggctggggatggttagctttttgtcccaaa
aaacaagagcttgtggtacagaccacagcaaaccaggatcctctagaggcgacgaccggg
atgatccctctcctaggagtagatgtgtgggagcacgcatattatctccagtataaaaat
gtgagaatagattatctaaaaagtttcccgagcataattaattgggattatatagagaat
cgctttgtagaaatgagcaagcaataa

DBGET integrated database retrieval system