KEGG   Chlamydia trachomatis L1/440/LN: L1440_00562Help
Entry
L1440_00562       CDS       T02571                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ctll  Chlamydia trachomatis L1/440/LN
Pathway
ctll00061  Fatty acid biosynthesis
ctll00780  Biotin metabolism
ctll01100  Metabolic pathways
ctll01212  Fatty acid metabolism
Module
ctll_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ctll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    L1440_00562
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    L1440_00562
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ctll01004]
    L1440_00562
Enzymes [BR:ctll01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     L1440_00562
Lipid biosynthesis proteins [BR:ctll01004]
 Fatty acid synthase
  Component type
   L1440_00562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: CCP62575
LinkDB All DBs
Position
complement(596988..597449)
Genome map
AA seq 153 aa AA seqDB search
MNEKPVLGIQDIQNLLPHRYPFLLVDKILSYDLNTRSVVAQKNVTINEPFFAGHFPGAPI
MPGVLILEALAQAAGVLLGIILENDRDKKIALFLGIQKAKFRQPVKPGDVLTLKAEFSLI
SAKGGKAFAQAFVGSQVVAEGELSFVLVKKESI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaagcccgtgttaggtatacaggacatacaaaatttacttccccatcggtat
ccctttttattggtggataaaattctttcttacgatttaaacactcgttcggtagtggct
cagaaaaatgtaacaattaacgaacctttttttgcgggacattttcctggagctcctatc
atgcccggagttttaatactggaagctttggctcaagctgctggagtgttgttagggatt
atattggaaaacgatcgagataaaaagatcgctttgttcttaggtatccagaaagcaaaa
ttccgtcagcctgttaaacctggagacgtattaaccttgaaagccgagttctctttaatc
tcggctaaaggtgggaaggcttttgcacaagcctttgtaggttctcaggtagtcgctgaa
ggagagctcagctttgttcttgttaaaaaagagtccatataa

DBGET integrated database retrieval system