KEGG   Chloracidobacterium thermophilum: Cabther_A0074Help
Entry
Cabther_A0074     CDS       T01629                                 

Definition
(GenBank) Kef-type K+ transport system, predicted NAD-binding component
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
ctm  Chloracidobacterium thermophilum
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cabther_A0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N TrkA_C PK_C
Motif
Other DBs
NCBI-ProteinID: AEP10854
UniProt: G2LFC1
LinkDB All DBs
Position
1:90288..92300
Genome map
AA seq 670 aa AA seqDB search
MHIEIPVLRDIVLLLLASLPIVFVCGRLRLPTIIGYMLTGVVIGPSGLGVIGDVHAVETL
AEIGVVLLLFTIGLEFSLEKLLAMQRVVFLGGGMQVGVTIVAAMLLAHWGVGLAWPSAIF
VGFLVALSSTAIVLKTYVDRAESDTPHGRMAIGILLFQDLCIVPMMLFLPLLSGQRTANL
WYILKTLGLAAGSVLLIMLLARRVFPFLLQWLVTLRSREVFVSFAVLACLGTAWLTSQAG
LSLALGAFIAGVVLSESEYSHQIVADILPFRDIFNGIFFVSIGMLLSLEVLTTTWPVVLG
LVALIVVGKTVLAFAAIKALGRTPRVALMAALGIAQIGEFSFVLLKVGAEAGLLEGAAYQ
TFLAASILTMLATPFLIALAPALGYQAGRWTGIADTPDTGAAELPPVSGHVIIAGYGLNG
RNLARVLRAAGIPYRIIELNIESIRAGRKQGEPILYGDGTRREVLHAARIEAARVLVVAI
SDATATRRIAALAREMNPNLHIIVRTRFVSEMNGLYALGVQQVIPEEFETSLEIFARVLR
EYGLSRQYIQQQVEMIRREGYRLLDADCPERTTLITELATVIENATTLALRLPSEGLAIG
QSLRKLALRPTFGVTVVAVQRGAETTVNPDADFVLEAGDVLVLLGRPEKLESAAAYLTGQ
ASLVEGERVP
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcgagattcctgtgctgcgggatattgtcctgctgctgctggcttcactgccc
attgttttcgtctgtggacggctgcggctgccgaccatcatcggctacatgctgaccggg
gtggtcattggcccgtctgggttgggcgtcattggtgatgtgcatgccgtcgagacgctg
gccgaaatcggcgtcgtgttgttgctgttcacgattgggctggaattctcgcttgaaaag
ctgctggccatgcagcgggtcgtgtttctgggtggcgggatgcaggttggcgtgacgatt
gtcgccgccatgctgctggcccactggggcgttggtttggcgtggccatcggccattttc
gttggctttctcgtggcgctttccagcacggcgattgttctcaagacctacgtggaccgg
gctgagtccgacacgccgcacgggcggatggcgattggcattttgctgtttcaggacctg
tgcatcgtcccgatgatgttgtttctgccgctgctgtcggggcagcggacggccaacctc
tggtacatcctgaaaaccctggggctggctgctgggtctgtgttgctcatcatgctgctg
gcgcggcgtgtctttccctttctgctgcagtggctggtgacgctgcgcagccgggaggtg
tttgtgagttttgccgtgctggcctgtctgggaacggcctggcttacgtcccaggccgga
ttgtcgctggcgctcggcgcgttcattgccggggtggtgctgtcggagtcggagtacagc
caccagatcgtggcagacatccttccgtttcgggacatcttcaacggcatcttttttgtg
tccatcgggatgctgctgtcgctggaggttctgacgacgacctggccggtggtgttgggg
ttggtggcgctcattgtggtgggcaaaacggtgctggcatttgcggccatcaaggcgttg
ggtcgcacgccgcgcgtggctttgatggcggctctgggcatcgcccagattggggagttt
tcgttcgtcctgctcaaggtgggagctgaggccggtctgctggaaggcgcggcttaccag
accttcctggcggcttcgattctgacgatgctggccacgccgtttctcattgctctggct
ccggcgcttggctaccaggctggccggtggactggcattgctgacaccccggacacggga
gcggctgaactgcccccggtgagcggacacgtcatcatcgccgggtatggtctcaacggg
cgcaatctggcgcgggttctccgggcggcaggcattccctaccgcatcattgaactcaac
atcgaatccatccgggctggtagaaagcagggcgaacccattctttatggcgacggaacc
cgccgtgaggtgctgcatgcggcccggatcgaggcggcccgcgtgctggtcgtcgccatt
tcggatgccacggccacccggcgcattgcggcgctggcgcgtgagatgaaccccaatctg
cacatcatcgtgcggacgcgcttcgtctcggagatgaacggcctctatgccttgggtgtc
cagcaggtcattcctgaagagttcgagacgagtctggagatttttgcccgcgtgttgcgc
gagtatgggctgtcgcggcagtacattcagcagcaggtggagatgattcgccgcgagggc
taccgcctgctcgacgccgactgcccggagcggacgacgttgattaccgagctggcgaca
gttatcgagaacgcgacgacgcttgccctgcgcctgccctccgaagggctggcgattggc
caatccctgcgcaagctggccttgcgtccaacctttggggtgacggtggtggctgtgcag
cggggcgcggaaacgacggtcaatcccgatgccgatttcgtactcgaagccggggatgtc
ctggtgttgctggggcgtcccgaaaagctggaaagcgcggcggcatatctgaccggccag
gcgtccctggtcgagggagagcgggtgccttga

DBGET integrated database retrieval system