KEGG   Chloracidobacterium thermophilum: Cabther_A0491Help
Entry
Cabther_A0491     CDS       T01629                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ctm  Chloracidobacterium thermophilum
Brite
Enzymes [BR:ctm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cabther_A0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEP11252
UniProt: G2LI36
LinkDB All DBs
Position
1:576095..576694
Genome map
AA seq 199 aa AA seqDB search
MPFDLPELPYAKDALAPHISATTFEFHHGKHHKAYVDNTNKLIEGTPHADKSLEEIIQAA
HTDGNAALFNNAAQVWNHTFFWNSMKPNGGGAPTGELADRINHAFGGLEQFKEAFKQAGV
TQFGSGWAWLVLDHGDLKIIKTANADLPLVHGQTALLTCDVWEHAYYLDFQNRRPDFLQA
YLDYLINWDFAAANLAQAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgacctgccagaactaccttacgccaaggatgcccttgcaccgcatatttcg
gcgacgacattcgagttccaccacggcaaacaccacaaggcctatgtggacaacacgaac
aaactcatcgaaggcacgccccatgccgacaaatcactggaagaaatcatccaggccgcc
cataccgatggcaatgcagccctgttcaacaacgctgcccaagtctggaaccacaccttt
ttctggaattcgatgaagccaaacggcggcggcgcaccgacgggtgagctggccgaccgc
atcaatcatgccttcggcggacttgagcaattcaaggaggctttcaagcaggccggcgtg
acgcagtttggcagcggttgggcctggctcgtccttgaccatggcgacctgaaaatcatc
aaaaccgctaacgccgacctgccgctcgtccacgggcagacggcgctgctgacctgcgat
gtctgggaacatgcctactatctcgactttcagaaccgccgcccggatttcctccaggcg
tatctggattacctgatcaactgggattttgcggcggccaatctggctcaggcggcctga

DBGET integrated database retrieval system