KEGG   Chloracidobacterium thermophilum: Cabther_A1394Help
Entry
Cabther_A1394     CDS       T01629                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00970  Aminoacyl-tRNA biosynthesis
ctm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cabther_A1394
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ctm03029]
    Cabther_A1394
Enzymes [BR:ctm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cabther_A1394
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cabther_A1394
Mitochondrial biogenesis [BR:ctm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cabther_A1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AEP12145
UniProt: G2LG32
LinkDB All DBs
Position
1:complement(1660295..1661794)
Genome map
AA seq 499 aa AA seqDB search
MTDLTKLLREKYEPVIGLEIHAQLKTRTKIFCPCPTDFGAEPNANTCPVCLGLPGALPVL
NQLVVEKAALAAFALNLHINETSVFARKNYFYPDLPKGYQISQYDQPFSVSGYVEIPTSE
RDETGRPVEWRLKTFRIQRMHIEEDAGKSLHEGMPDSDTSSYVNLNRSGVPLVEIVSEPD
FRSSWEAYDYVQYLRRALLYVDACDGNMEEGSLRCDANVSIRRRGSTTFGTRTETKNLNS
FRFIQRAIDYEIARQIRILEEGGHIVQETRLWSEREARTYTMRSKEEAHDYRYFPEPDLP
PLVLTAETIAALRSRMPELPEPRRRRFAESYGLSFEDSSLMTTTREMADFFEACVEASGN
ARAAFNWIANELLARIPAEKLSLETSPIAPTALAELIGLIADGTLSTKLAKEVFERMLTT
GKAAREIVQELGGGQVSDVGQIEAIAAEVIAANPKQAAEYRGGKTPLLAFFVGQVMKATK
GKANPQVVNEVLKRLLDTP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttaccaagcttctgcgtgaaaagtatgagccggtcatcgggttggaaatt
cacgcgcaattgaagacccgtacaaaaattttttgtccctgcccgactgactttggggcg
gaaccgaatgccaacacctgtccggtgtgtttggggctgcccggagcacttccggtgctc
aatcagttggtggtggaaaaggctgcgttggctgcgtttgccctcaatttacacatcaac
gaaacttcggtttttgcgcgaaaaaattacttctacccggacctgcccaagggctatcag
atttcccagtacgaccagcccttttcagtttccgggtacgtggaaatcccgaccagtgaa
cgggatgaaaccggccgcccagtggaatggcgcctgaagacgtttcgcatccagcggatg
cacatcgaggaagacgctggcaaaagccttcacgaagggatgccggattcggatacctca
tcttatgtgaacctcaaccggagcggtgtgccactggtggagattgtcagcgagccggat
ttccgcagcagttgggaagcctacgactatgtgcagtacctgcggcgcgccctgctgtat
gtggatgcctgcgacggcaacatggaagaaggcagcctgcgctgcgacgccaatgtctcc
atccggcggcgcggcagcacgacgttcggcacccgtacggagaccaaaaacctcaactcg
ttccggttcatccagcgggcgattgactacgaaattgcccggcagatacggattctcgaa
gaaggtgggcacatcgtgcaggaaacgcgcctgtggagcgagcgcgaagcccgcacctac
accatgcggagcaaggaagaggcccacgactaccgctactttcccgaacctgacttgccg
ccgctggtcctcacggccgaaaccattgcggctttgcgcagtcggatgccggagcttccc
gaaccccgccgccgtcgctttgcagaaagctacgggttgtcgtttgaagattcctcgttg
atgacgacgacccgcgaaatggccgatttctttgaagcctgtgtcgaagccagcggcaac
gcccgcgcggctttcaactggattgccaacgaattgctggcacgcatcccggctgaaaaa
ctttctctggaaacttcaccgattgccccgacggcgctggcggaactcatcggcctgatt
gccgacgggacactcagcaccaagctggccaaggaagtcttcgagcggatgttgaccacc
ggcaaagcggcccgggagattgtccaggaactgggtggcgggcaggtgtcggatgtcggg
cagattgaagccattgccgccgaggtcatcgccgccaacccgaagcaggcggctgaatac
cggggcggaaaaacacccttgctggcgtttttcgtggggcaggtgatgaaggccacaaag
ggcaaagccaatccccaggtggtcaacgaagtgctcaaacgcctgctcgacactccatga

DBGET integrated database retrieval system