KEGG   Chloracidobacterium thermophilum: Cabther_A1469Help
Entry
Cabther_A1469     CDS       T01629                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ctm  Chloracidobacterium thermophilum
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ctm01001]
    Cabther_A1469
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Cabther_A1469
Protein kinases [BR:ctm01001]
 Serine/threonine kinases: Other
  Bacterial family
   Cabther_A1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGE-sulfatase Pkinase Pkinase_Tyr APH Kdo Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: AEP12219
UniProt: G2LHF6
LinkDB All DBs
Position
1:1758744..1760906
Genome map
AA seq 720 aa AA seqDB search
MAKQPELTSDAIEQTRLAASAGALTGELTDQTQVSVTETGAGAQTDLVVEHTIQLGTGPV
DQRETARAQPPSTQPVGMETTSPPRQRPVEGLAIGQRFQGKYEILRLLGVGGMGRVYKAR
HCELDTLVAIKIMVGSLSSDREAIERFKREARAMARVQHPNAVRVLDSGVEQGDCYLIME
FLEGETLREHMTRLRQQGTSPSLETIIRYAEQVFAVLEFMHRQNITHRDLKPDNIFLART
PDGEEIVKVLDFGIAKIQTATVVGMTTEGTMMGTPRYMSPEQCRGAAIDGRADIYSMGVV
LYEMLAGQPPFDGDTAIAVALKHVNEPPPPLRELNPNVPEAVAAVIHRALEKSPSQRFRT
AQEFSQALLKAAGLAPAQPGLPAAVAPSLGIPSEDVPTLKRPADSGDTRPYGSGLPLDEG
AAKRPNWFLAAAAGIIVLGLIVVGVQLSWQSVSQPASPVTSPSPSAPAAPKVLENFILIP
AGTFTMGRDAGPDDFTSDKRVPADETPAHQVTVPAFYLAKYETTNAEYKRFVAATGHRAP
RSWKQGNYYPPGQDDFPVTDISWQDAVAYCDWLTKTNGEGITFRLPTEAEWEYAARGTDG
RLFPWGSFWRDGTANTRQAKGTNEVLLLPVNVEPNNTRDKSAFGVFGMGGNVCEWTASDF
APYPGSPYRPTGRDLECKVYRGGHFASPLSDALASSRKWTLPDKTQEFLGFRVAATPAQP
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcaacctgagttgacatccgatgccatcgagcaaacccgccttgcggcatca
gccggcgctctgacgggggagctgactgaccaaacccaagtctctgtcacagaaactggt
gccggggcgcaaactgacctggtggtggagcacaccatccagcttggcacagggccggtg
gaccagcgggaaaccgcccgggcccagccgccttccactcaacccgtcggcatggagaca
acctctcctccaagacaacgtccggtcgaagggctggctatcgggcaacgcttccagggc
aagtacgaaatcctccggctgcttggcgtcggcggcatggggcgggtctataaggcacgt
cactgcgaactcgatacgcttgtcgccatcaaaatcatggtcggcagcctgtcgagtgac
cgtgaagccatcgagcgtttcaagcgtgaggcccgggcaatggcgcgcgtccagcatccc
aatgccgtacgggtgctcgattccggcgtcgagcagggggattgctacctcatcatggag
ttcctcgaaggcgaaacgctccgggaacacatgacgcgcctgcgccagcagggcacatcc
ccttcgctggaaaccatcatccgctacgccgaacaggtttttgccgtgctggagttcatg
caccggcaaaacatcacgcaccgcgacctcaaacccgacaacatctttctggcccgcacg
cctgacggagaagaaatcgtcaaggtgctcgacttcgggattgccaaaatccagaccgca
accgtggtcggcatgacgaccgagggtacgatgatgggcacaccgcgctacatgtccccg
gaacagtgccgtggggcggccattgacggacgtgcggacatctactccatgggcgtcgtg
ctctacgaaatgctggccggtcaaccacccttcgacggcgacacggccattgccgtcgcc
ctcaaacacgtcaatgagccgccacccccactgcgggaactcaaccccaacgttcccgaa
gccgtggccgccgtcatccaccgcgcccttgaaaaatcgcccagtcaacgtttccgcacg
gcgcaggaattttcgcaggcgcttctgaaagccgccggactggcaccggcacagccggga
ttaccggcggccgtcgccccttcccttgggattccgagcgaggacgtgcctacgctgaag
cgaccggccgacagcggggacacgcgcccctacggcagcggtctgccgctggacgaaggt
gcggccaagcggcccaactggttccttgccgccgccgccggcatcattgtcttgggactg
atcgttgtcggtgtacaactgtcttggcaatctgtgtcccagccggcttcacctgttaca
tccccgtccccaagtgccccggcagcgcccaaggtgctggaaaacttcatcctcattccg
gcgggaaccttcaccatggggcgcgatgccggcccggacgatttcacctccgacaagcgc
gtgccggcggatgaaacccctgcccaccaggtcacggtcccggctttttatctggcgaag
tatgagacgaccaatgccgagtacaaacgctttgttgcagcaacgggccaccgggcaccg
cgaagctggaagcagggcaactattatccgcccggacaggacgatttcccagtcacagat
atctcctggcaggacgcggtagcctactgcgactggcttacgaagacgaacggcgaaggc
attaccttccgcctgcctactgaagctgaatgggaatacgccgcacgtggcacagacggg
cgtcttttcccgtggggcagcttctggcgcgatggcaccgccaacacccggcaggcgaaa
ggcaccaacgaggtactgctgctgccagtcaatgtcgagccgaacaacacccgcgacaaa
agcgcctttggcgtctttggcatggggggcaacgtgtgtgagtggacggcatccgatttc
gcgccgtatcccggcagcccctaccgcccgaccgggcgtgatcttgaatgcaaggtgtat
cgcggcggccactttgcctcaccgctcagcgatgccctcgcctccagccgcaaatggacc
ttgcccgacaaaacccaggaattccttggctttcgtgtcgccgctaccccggcgcaacca
tga

DBGET integrated database retrieval system