KEGG   Chloracidobacterium thermophilum: Cabther_A2240Help
Entry
Cabther_A2240     CDS       T01629                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00620  Pyruvate metabolism
ctm00680  Methane metabolism
ctm01100  Metabolic pathways
ctm01120  Microbial metabolism in diverse environments
ctm01200  Carbon metabolism
Module
ctm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cabther_A2240
  09102 Energy metabolism
   00680 Methane metabolism
    Cabther_A2240
Enzymes [BR:ctm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cabther_A2240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase TusA PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEP12975
UniProt: G2LF47
LinkDB All DBs
Position
1:complement(2648713..2651460)
Genome map
AA seq 915 aa AA seqDB search
MTVPTASSALADLARAERDYRFLVACFQEVLSETGAPELARALPIEGTAPLPETSHERFV
QACSVVFQLLNMAEENAAAQNRRALESSAGCAAEPGLWGAVLHKLRRQGRSAADILTALA
QLHVEPVLTAHPTEAKRATVLEHHRRLYLLLVKLENSVWTPNERRAIRDEIKRELERLWR
TGEIYLEKPTVADELRNVLHYLTTTLPEAVGWMDRHLLDAWDELGMEAAMRPTDPAHLPR
ITFGTWVGGDRDGHPLVTPETTRESLHTLRQAALRLFRSRLTELAARMSLSDRRQSPPAA
LMAYLSTAREAHDPVLQSALERNPYESWRQAVNVMLARLPGAELGWPTARQPYTAASELA
ADLRLLGETLLAVGAKRLCESEVWPLLRLVETFGFHLAVLDIRQNSAVHEQAVVEWLRAA
GVEAEYDQWDEARRCAFWETELAQTRPLAVLGAPPGDAAGRVVGALQVAAEYGQQYGWSG
LGALIVSMTRATSDLLAVYGLAREAGLTISTSDGLVCPLPVVPLFETLDDLRHSPDILSA
FLDHPMTRRSLAWMQRPGQPPVQQVMIGYSDSNKDAGAVASLWGLYRAQQALSAVAQARG
VLLRFFHGRGGTPSRGAGPTHRFLNALPPESVSGRLRLTEQGETISQKYANLITATYELE
LLTAGMLETYLLAQSTTKTPHPLEPVLDFLADESHRAYRALLELPGFLEFFAHATPIDAI
EASRIGSRPSRRTGKRTLADLRAIPWVFSWSQARFFLSGWYGLGTALDMLATHHPKWLMQ
LRQEALRWYPTRLLLMNAGSQLLLADAAWMQAYAELVPDTIARTTVLSTILAEFERTRRG
VEQVFGVPLTERRQRTALTMQLRRAGLAALHQRQIELLKAWRAARAASDDTQSESLLVDL
LLTINAISSGLKSTG
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcctacggcttcatcggcgctggctgacctggcccgtgccgagcgcgactat
cggtttctcgtggcgtgttttcaggaggttttgtcggagacaggcgctccagagctggcg
cgggccctcccgatagagggaacggcacctctgccagaaacctctcatgagcgttttgtt
caggcctgctcggtggttttccaactgctcaacatggccgaagaaaatgccgctgcgcaa
aaccggcgggcgcttgagtccagcgccggctgtgctgccgagccggggctgtggggcgca
gtgctgcacaagctacgccgccagggacggtctgcggcagacatcctgacggcgctcgcg
cagcttcatgtcgaaccggttttgaccgcccatcccactgaggccaagcgggcgaccgtg
ctggagcaccaccggcggctttacctgcttctggtcaagctcgaaaactcggtgtggacg
cccaatgaacgccgcgccatccgggacgagatcaaacgcgaactggagcgtctgtggcgg
accggtgaaatttatctcgaaaaaccgacggtcgccgacgaactccgcaacgttctccat
tacctgacaaccaccctgccggaagccgttggctggatggaccggcacttgctcgatgcc
tgggatgaactggggatggaggccgcgatgcgcccgacagacccggcacacctgccgcgt
atcacgtttggcacatgggttggaggggatcgtgatggccacccgctcgtcaccccggaa
acgacccgtgagtctctgcacacgctccgccaggctgcactgcggttgttccgttcccgg
ctgacagaactggcggcgcggatgagcctttcggatcgccgccagtcgccgccggcggcg
ctgatggcgtacctgtccacggcgcgggaagcgcacgacccggttctccagtcggcgctg
gagcgaaacccttacgagtcgtggcggcaggcggtcaacgtcatgctggcccgcctgcca
ggcgcagaactgggctggccgacagcgcgccagccctacactgcggcatcggagctggct
gccgatctgcgcctgctgggcgagacgttgcttgcggttggcgcaaaacggttgtgtgaa
tcagaagtctggccgctgctccgtctggtggaaacgtttggatttcacttggcggtactt
gacatccggcaaaacagcgccgtgcatgaacaggcggttgtcgaatggctccgggccgct
ggcgtagaagccgaatatgaccagtgggatgaagcccgccgctgcgcgttttgggaaacg
gaactggcccagacgcgaccgttggccgtacttggcgcaccgcctggtgatgccgctggg
cgtgtggttggcgccctgcaggtggcggctgagtacggccagcaatacggttggtcaggg
ctgggcgcgctgattgtgagcatgacccgcgcgacttccgatctcctggctgtgtacggg
ctggcacgtgaagccgggctcaccatctccacgtccgacggactggtatgcccgctgccg
gttgttccgctttttgaaaccctcgacgatttgcggcacagcccggacattctgtcagct
tttctggaccatccgatgacgcgccgcagtctggcctggatgcagcgccccggacagccg
cctgtgcagcaggtcatgattggttacagcgacagcaacaaggacgccggcgctgtcgcc
agtctgtggggactttaccgggcccagcaggccttgtcggctgtggcccaggcgcgtggg
gtactgctgcgcttctttcacggtcgtggtggcacgccgagccgtggcgccggccccacc
catcgctttctcaacgctctgccgccggagtcagtgtcaggacgcctgcggctgacggaa
cagggcgaaacaatttcacaaaaatacgccaacctcatcacggccacctacgaactcgaa
ctgctcacagccgggatgcttgaaacctacctgttggcgcaatccactacgaaaacaccc
cacccccttgaaccggtgcttgacttcctcgccgacgagagtcaccgcgcctaccgggcg
ttgctggaactacccggctttctggaattttttgcccacgccacgccgatagacgccatt
gaggccagccgaatcggatcgcgcccgtcacgccgtaccggaaagcgtaccctggctgac
ctgcgcgccattccctgggttttcagttggagccaggcacggttttttctctccggctgg
tacggacttggcacggcgctggacatgctggccacacaccatccgaagtggctgatgcaa
ctgcgccaggaggccctgcggtggtatccaacccggctgcttctgatgaatgccggcagt
cagcttcttttggctgacgcggcctggatgcaagcctacgccgagttggtgcctgatacc
atcgcccgaacgactgtgctttcgaccattctggctgagtttgagcggacgcgccgtggc
gtcgagcaggtttttggcgtaccgcttacggaacgtcgccagcgaacggcgcttacgatg
cagctccggcgggccgggctggcagcactgcaccagcggcagattgaactcctcaaggcc
tggcgcgcggcccgcgcggcatcggatgacacacaaagcgaaagcctgctggtggatctg
ctgttgaccatcaacgccatttcaagcggtctcaagagcaccggctga

DBGET integrated database retrieval system