KEGG   Chlamydia trachomatis L2c: CTL2C_47Help
Entry
CTL2C_47          CDS       T01574                                 

Gene name
murC
Definition
(GenBank) UDP-N-acetylmuramate--alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
cto  Chlamydia trachomatis L2c
Pathway
cto00471  D-Glutamine and D-glutamate metabolism
cto00550  Peptidoglycan biosynthesis
cto01100  Metabolic pathways
cto01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cto00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CTL2C_47 (murC)
   00473 D-Alanine metabolism
    CTL2C_47 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CTL2C_47 (murC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CTL2C_47 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cto01011]
    CTL2C_47 (murC)
Enzymes [BR:cto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CTL2C_47 (murC)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     CTL2C_47 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:cto01011]
 Precursor biosynthesis
  Amino acid ligase
   CTL2C_47 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N Mur_ligase Mur_ligase_C Mur_ligase_M CPSase_L_D2 ATP-grasp GARS_A ATP-grasp_4 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AEJ76971
LinkDB All DBs
Position
174722..177130
Genome map
AA seq 802 aa AA seqDB search
MKSLFYHFIGIGGIGMSALAHVLLDRGYSVSGSDLSEGKVVEKLKNKGAEFFLGNQEEHI
PEGAVVVYSSSISKENPEFLSAKSRGNRVVHRAELLAELAQDQISIFVTGSHGKTTVSSL
ITAILQEAKKNPSFAIGGLNQEGINGGSGSEYFVAEADESDGSIRCYTPEFSVITNIDDE
HLSNFEGDRELLLASLKDFALKTQQICWYNGDCPRLRSCLQGHTFGLDSSCDLHILSYYQ
EGWRLYFTAKYQDVVYADIEVQLVGMHNVLNAAAAMGIALSLGIDEGAIRNAFRGFSGVQ
RRLQRKNSSETFLFLEDYAHHPSEISCTLRAVRTAVGQRRILAICQPHRFSRLRECIDSF
PSAFKDADEVLLTEVYSAGEEAEDISYQELAEAISQESIVKCTHIPFHELQRHLEQSIRV
HDVCVSLGAGNIVNLGEKLRDFEPQKLHLGIICGGKSCEHEISVLSAKNIAKHLSKSFYD
VSYFLITREGLWESVSSLETAEDSGKSVFDPEIAQRLEKVDVVLPILHGPYGEDGAMQGF
LETIGKPYTGPAIAFSAIAMNKVFTKRFMSDLGIPVVPYLPLTLAGWKQEQDKWLAHIVE
AFSFPMFVKSSHLGSSIGVFEVHNVIELRDAINEAFMRDNDVFVEENRLGCKEIEVSVLG
DGSGAFVIAGLHERRGSGGFIDYQEKYGLSGKSSAQIVFDTDLSKEIQEQILEAADKIYR
LLLGKGSCRIDFFVDEEGNFWLSEMNPIPGMTETSPFLTSFIRKGWSYEQIVHQLVIDGL
QRFNQRQRLISTSFVDQAFAIQ
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttgttttaccactttattggtattggtgggattggaatgagtgctttagca
catgttctgctcgatcgaggatatagcgtatcgggaagtgatctttccgaggggaaagtg
gtagagaagctgaagaataaaggagcggaattctttttagggaatcaagaagaacatatc
cctgaaggcgctgtagttgtatacagttcaagtatttctaaagaaaatcctgaattttta
tcagctaaaagtagagggaaccgtgtagttcatcgagccgaattattagccgagcttgct
caagatcagatttctatttttgttacaggaagtcatgggaagacaacagtctcttctttg
atcacagccattttgcaggaagcaaagaaaaatccgtcctttgctataggaggtttgaat
caagaaggcatcaatggtggttcgggatctgaatattttgttgctgaagcagatgaaagc
gatgggtctattcggtgttatactccagagttttctgttattacgaatatagatgatgag
catctgtctaattttgaaggagatcgagagcttcttctggcttctttgaaagactttgca
ctcaagactcagcagatctgttggtataatggagattgtcctcgcttgcgttcatgcttg
caagggcatacttttggattggactcttcttgtgatctacatattctatcttattatcaa
gaaggatggagactgtactttacagcaaagtatcaagatgtagtgtatgcagatatagaa
gtgcaattggtcggcatgcataacgttttgaatgctgcagcagctatgggaatagctctg
tcattgggtatagatgaaggtgctataagaaatgctttcagagggttttcaggagttcaa
agacgattacaaagaaagaattcttctgagacctttctctttttagaagattatgcacac
catccttcagagatttcttgtacattacgtgctgttcgtactgctgttggacagagacgt
attttagctatttgccagcctcatcgtttttctcgattaagagagtgtatagacagcttc
ccgtcagcatttaaagatgctgatgaagtcttgttaacagaagtgtacagtgcgggagag
gaggcggaagatatctcgtaccaagagcttgctgaagctattagtcaagagtcgatagta
aagtgtacgcatattccgtttcatgagttgcagagacatttagagcagtccatccgtgta
cacgatgtgtgtgtatctttaggtgctggtaatattgtgaatttgggagaaaagttaaga
gattttgagcctcaaaaactgcacttaggaattatttgtggagggaaatcatgcgaacac
gagatttccgttctatctgcaaaaaatatagctaaacatctttcaaaatccttttatgat
gtgagttattttttaattactcgagaaggattatgggagagcgtctcttcattagagact
gctgaagactcagggaaatccgtttttgatccagaaatagctcagagactagaaaaagta
gacgtagtgttgccgatactacatggtccctatggtgaagatggagctatgcaaggattt
ctagagactattggtaagccttatacaggtcctgctatcgctttttctgcgatagcaatg
aataaagtgtttactaagcgctttatgagtgatttagggattcctgtcgttccttatctc
cctttaacattagcaggatggaagcaagaacaagataagtggttagcacatattgtagag
gctttttcatttcctatgtttgtgaaatcttcgcatttaggatctagtatcggcgtcttc
gaagttcataatgttatagaattacgagatgccattaatgaagcttttatgcgagataac
gacgtgtttgtagaagaaaatcgcttaggttgcaaagaaatagaagtttctgtcttagga
gatggatctggtgcgtttgtcattgctggtctgcatgagcgtcgtgggagtggaggtttt
atagactatcaagagaagtatgggttaagtggcaagtctagtgcgcagatcgtatttgat
acagatctctctaaagaaatacaggaacaaatactagaagctgcggataaaatttaccgt
ttattgctagggaaagggtcgtgtcgtattgacttttttgtagatgaagaaggaaatttc
tggttatctgagatgaaccccattcctggaatgacagaaacgagcccatttcttacatct
ttcattcgtaaagggtggagttatgaacagatagtccatcaacttgttattgatgggctg
caacgatttaaccaacgccaacgcttgatatcaacgtcttttgtagatcaagcgttcgct
attcagtaa

DBGET integrated database retrieval system