KEGG   Candida tropicalis: CTRG_00164Help
Entry
CTRG_00164        CDS       T01115                                 

Definition
(RefSeq) histone deacetylase HOS3
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
ctp  Candida tropicalis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ctp03036]
    CTRG_00164
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CTRG_00164
Chromosome and associated proteins [BR:ctp03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     CTRG_00164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl SF3A3
Motif
Other DBs
NCBI-GeneID: 8300591
NCBI-ProteinID: XP_002545383
UniProt: C5M275
LinkDB All DBs
Position
Unknown
AA seq 718 aa AA seqDB search
MASTNHSNDSEDSLIEAFETTLTIRPTTTEYEDDISIDHTTLPNTTYNFTSTSIVGIEEL
EENEQISEQIPKFKTKRRYSLLPKITEFKKTGSPGLEEYYNQQKIDPKFDAILKPSPLLD
ESLEKYYHTFHDFLTSNPHIENESPRFLHDSSKTLVLLSPYSAEHAFGRKWVTKSYLSTI
FERPQRLLASCIGVAAAVTMFPFYYKVSNSTKRGSVFSSHVRKIHGKNWPKKLFELCLES
HEKLNKNEMEVPNDWNTGDIYLTPKTINAIEGVIGTIETAVDSLFSKKKKENHNLAFVVI
RPPGHHSHACLPSGFCLLNNVQIGIEYAFEQYGVTHCAILDIDLHHGDGSQDICWERAGF
TGDYGQQEEDEIIDPKLNPRDDYGKRFATFPKVGYFSLHDIKSYPTEIGYATKENIKNAS
TCIMDHDLNIWNVHLQEWSNEDEFYKHYQTRYVSILNRANQFLNNSKKQYEQEYQEYLDQ
MAQYNKFLQKPHLFNQPVVQPTPPPPFKPLIAISAGFDASEYENPQMQRHGINVPTSFYA
TFTNDVVKLAKIHTNGKVLSFLEGGYSDGALSTGIFSHLIGLNNDDEFLWNHSWGSNQVM
KELIKGCKKNWTPYKKPQSDITIWANEVIKLGRSMMPNAVLPANYIYDDQTKSANNKHMN
KMVKEILDRGNSSIRLDSPIRRDPDDERKVMRHTRSYHKKVTNSNNNHGSGNVNSLYD
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaccaatcattctaatgacagtgaagattcattgattgaagcttttgaaaca
acattaacaatacgtccaactactacggaatatgaagatgatatctccatagatcacacc
acattaccaaacacaacatataacttcacatctacaagtattgttggaattgaagaattg
gaagaaaatgaacaaattctggaacaaatcccaaagtttaaaactaaaagaagatatagt
ttactacctaaaatcaccgaatttaagaagactggatctccgggtttggaagaatactat
aatcaacaaaaaattgatcctaaattcgatgcaattttaaaaccatctccattacttgat
gaatcattagagaaatattatcatacatttcatgattttttaacttcaaatcctcatatt
gagaatgaatcaccaagattccttcacgattcaagcaaaactttagtattattatctcca
tattcagcagaacatgcatttggtagaaaatgggttacgaaatcatatttatcaactata
tttgaacgtcctcaaagattattggccagttgtattggggtagctgcagctgttaccatg
tttccattctattataaagtttcaaattctactaaaagaggatctgtattttcatctcat
gttcgtaaaattcatggaaaaaattggccaaagaaattatttgaattatgtttagaatct
catgaaaaattgaataaaaatgaaatggaagttcctaatgattggaatactggtgatatt
tatttaaccccaaaaaccatcaatgcaatcgaaggggtaatcggtactattgaaaccgca
gttgattcattgtttctgaaaaagaagaaggagaatcataatttagcatttgttgtcatt
agacctccaggtcatcatagtcatgcatgtttaccaagtggattttgtttacttaataat
gtacaaattggtattgaatatgcatttgaacagtatggagttacacattgtgcaatttta
gacatagatttgcatcatggtgatggatcacaagatatttgttgggaaagagcaggtttt
acaggtgattatggacaacaagaagaggatgaaatcattgatcctaaattaaatcctcga
gatgattatggtaaacgatttgcaacttttcctaaagtgggttatttttcacttcatgat
atcaaatcttatccaacagaaatcggatatgctactaaagaaaatatcaagaatgcatcc
acttgtatcatggatcatgatttaaacatctggaatgttcatttacaagaatggtcaaat
gaagatgaattctataaacattaccaaaccagatatgtatcaattttgaatcgagcaaat
caatttttgaacaattcaaagaaacaatatgaacaagaatatcaagaatacttggatcaa
atggctcaatacaataaatttttgcaaaagccacatttatttaaccaaccggtagttcaa
ccaactccaccacctccatttaaaccattaattgccatatctgcgggatttgatgcatca
gaatacgaaaatccacaaatgcaaagacatggtatcaatgttcctacttcattttatgct
acttttacaaatgatgttgtcaaattagctaaaattcataccaatggtaaagtattatca
tttttagaagggggatattctgatggggcattatctactggtattttctcccatttgatt
ggattaaacaatgatgatgaatttttatggaatcattcatgggggtccaatcaagttatg
aaagaattgatcaaaggatgtaagaaaaactggactccttataagaaaccacaaagtgat
ataactatttgggctaatgaagtgattaaattaggtagatcaatgatgccaaatgctgta
ttaccagccaattacatttatgatgatcaaactaaatcagcaaataataaacacatgaat
aaaatggttaaagaaattttggaccggggtaattcaagtattagattagatagtccaatt
agaagagatcctgatgatgaaagaaaagttatgagacatactagatcatatcataagaaa
gtaactaattccaataataaccatggtagtggtaatgtcaatagtttatacgattaa

DBGET integrated database retrieval system