KEGG   Candida tropicalis: CTRG_00414Help
Entry
CTRG_00414        CDS       T01115                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp00051  Fructose and mannose metabolism
ctp00052  Galactose metabolism
ctp00500  Starch and sucrose metabolism
ctp00520  Amino sugar and nucleotide sugar metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
Module
ctp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ctp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_00414
   00051 Fructose and mannose metabolism
    CTRG_00414
   00052 Galactose metabolism
    CTRG_00414
   00500 Starch and sucrose metabolism
    CTRG_00414
   00520 Amino sugar and nucleotide sugar metabolism
    CTRG_00414
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CTRG_00414
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ctp04131]
    CTRG_00414
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CTRG_00414
Membrane trafficking [BR:ctp04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CTRG_00414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 8296095
NCBI-ProteinID: XP_002545633
UniProt: C5M2X5
LinkDB All DBs
Position
Unknown
AA seq 483 aa AA seqDB search
MVHLGPKPAQPRKGTFTDVPSQLLEAIKPFEKEFTISGETLRAIVAHFIKELNRGLSKQG
GNIPMIPGWVMEYPTGKETGNYLAIDLGGTNLRVVLVKLGGNRDFDTTQSKFALPSHMRT
ATKDELWDFIAKCLKQVVDEVFPEGVTQPIPLGFTFSYPASQDRINEGVLQRWTKGWAID
GIEGHDVVPMLQSAVKKVGVPINVVALINDTTGTLVASLYTDPETKMGVIFGTGVNGAYY
DVVGEIPKLEGRCGADIPPTSLMAINCEYGSFDNEHFILPRTKYDIQIDAESPKPGQQTF
EKMNSGYYLGELLRLILLELADEKKLIFKGQNIDKLRKPYVMDTSFPSRIELDPFENLSD
VADIFQDELGIQTTEPERKIIRRLSELIGERSARLSVCGIAAICQKRGYETAHIAADGSV
FNRYPGFKERAAKALRDIYQWPATQKDPIVIVAAEDGSGVGAAIIAALTEKRLKEGKSVG
VIA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctcggtccaaaaccagctcaaccaagaaagggtaccttcactgatgtccca
agtcaattgttagaagctatcaaaccatttgaaaaggaatttaccatttctggtgaaact
ttgagagccattgttgcccacttcatcaaagaattgaaccgtggtttgtccaaacaaggt
ggtaacattcctatgattccaggttgggtcatggaatacccaactggtaaagaaaccggt
aactaccttgctatcgatttgggtggtaccaacttgagagttgttttggtcaaattaggt
ggtaacagagatttcgacaccactcaatccaaatttgctttgccatctcacatgagaact
gccactaaagatgaattgtgggatttcattgctaaatgtttgaaacaagttgtcgatgaa
gttttcccagaaggtgtcactcaaccaattccattgggtttcactttcagttatccagcc
tcccaagaccgtatcaacgaaggtgtcttgcaaagatggactaaaggttgggccattgat
ggaattgaaggtcacgatgttgttccaatgttgcaatctgctgttaaaaaggttggtgtt
ccaatcaatgttgttgctttgattaacgataccactggtaccttggttgcttccttatac
actgatccagaaaccaagatgggtgttattttcggtactggtgtcaatggtgcttactac
gatgttgttggtgaaattccaaaattggaaggcagatgtggcgctgatattccaccaact
tcattgatggctatcaactgtgaatacggttctttcgataacgaacactttatcttgcca
agaaccaaatacgatatccaaattgatgctgaatctccaaaaccaggtcaacaaactttt
gaaaagatgaactctggttactacttgggtgaacttttgagattgatcttgttggaattg
gctgatgaaaagaaattgatctttaaaggtcaaaacattgataaattaagaaaaccatat
gttatggatacttctttcccatccagaattgaattggatccattcgaaaacttgtctgat
gttgctgatatcttccaagatgaattgggtatccaaaccactgaaccagaaagaaagatc
atccgtcgtctttctgaattgattggtgaaagatctgccagattatctgtctgtggtatt
gctgctatctgtcaaaagagaggttatgaaaccgcccatattgctgctgacggttctgtc
ttcaacagatacccaggtttcaaggaaagagctgccaaggctttgagagatatctaccaa
tggccagctacccaaaaggacccaattgtcattgttgctgctgaagatggtagtggtgtt
ggtgctgctattattgctgctttgaccgaaaagagattgaaggaaggtaaatctgtcggt
gttattgcttag

DBGET integrated database retrieval system