KEGG   Candida tropicalis: CTRG_01001Help
Entry
CTRG_01001        CDS       T01115                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ctp  Candida tropicalis
Pathway
ctp00500  Starch and sucrose metabolism
ctp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTRG_01001
Enzymes [BR:ctp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CTRG_01001
Glycosyltransferases [BR:ctp01003]
 Polysaccharide
  Storage polysaccharide
   CTRG_01001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5 PNK3P
Motif
Other DBs
NCBI-GeneID: 8302146
NCBI-ProteinID: XP_002546219
UniProt: C5M4L1
LinkDB All DBs
Position
Unknown
AA seq 665 aa AA seqDB search
MTRDIANHLLFEVSTEVAHKVGGIYSVLKSKAPITVAEYRERYTLLGPLNHASAQIEVEE
LPVKDPMIKQTLDSMSAKGIRWLYGRWLIEGAPRVLLFDIWSAGHYLNEWKADLWNIAGI
PTPDHDSETNDAILLGYLVAWFLGELVYNDRDRAVICHCHEWLAGIALPLCRKRRIDLTT
IFTTHATILGRYLCAGSTDFYNNLDKFDVDAEAGKRGIYHRYCIERSATHSCDVFTTVSH
ITAYEAEHLLKRKPDGVLPNGLNVVKFQAVHEFQNLHAVKKDKINEFIKGHFYGNYDFDL
DNTLYFFIAGRYEFRNKGCDFFIEALARLNHKLKESGSKMTVVAFIIMPGKTQSYTVETL
KGQAVIKQLENSIEEVQKKVGDRLFEYCARYPNANHKSNDEVPSIDELIKPADRVLLKRR
IFALKRDGLPPIVTHNMVDDSNDPILNHIRRVQLFNRSEDRVKIIFHPEFLNANNPILSL
DYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMEDLIENTTDYGIY
IVDRRMKSVDESINQLTDYMYDFVGKTRRQRINQRNRTERLSDLLDWRRIGIEYVKARNL
ALKRAYPDYVGENIVESKVKLTRPMSVPGSPRSMLLTPGDLGSLQEMEMQEDAEYFELGD
GEEEA
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgactagagatattgccaatcatttattgttcgaggtatcgaccgaagttgcccacaaa
gtcgggggtatttactccgttttgaaatctaaagcaccaattactgttgcagaatacaga
gaacgttacactttacttggtcctttgaatcatgcttctgcccaaatcgaagttgaagaa
ttgcctgttaaagacccaatgattaaacaaactttggactccatgtctgccaaaggtatc
agatggttatatggtagatggttgattgaaggtgccccaagagttttgttattcgatatc
tggtctgctggtcattacttgaatgaatggaaagctgatttgtggaatattgccggaatc
ccaacccctgaccacgatctggaaactaatgatgccatcttgttgggttatttggttgct
tggttcttgggtgaattggtctataacgacagagatagagctgttatttgccattgtcac
gaatggttggccggtattgctttaccattgtgtagaaagagaagaattgatttgactacc
atcttcacaacccatgccactatcttgggtagatatctttgtgctggtagtactgatttc
tacaacaatttggacaaatttgatgtggatgcagaagccggaaagagaggtatctatcat
cgatattgtattgaaagatcagctactcattcttgtgatgttttcactactgtttcccac
attactgcttatgaagctgaacatttgttgaaaagaaaaccagacggtgtcttgccaaac
ggtttgaatgttgtcaaattccaagctgttcatgaattccaaaacttgcatgctgttaaa
aaggataaaattaacgaatttattaaaggacatttctatggtaattatgatttcgattta
gacaataccttgtatttctttattgctggtagatatgaatttagaaacaagggttgtgat
ttcttcattgaagcattggccagattgaaccataaattgaaggaatctggttctaagatg
actgttgttgcatttatcattatgccaggtaaaactcaatcatacactgttgaaactttg
aaaggtcaagccgttattaaacaattggaaaactctattgaagaagttcaaaagaaagtt
ggtgatagattatttgaatattgtgcaagatatccaaatgccaaccacaaatccaatgat
gaagttccttccattgatgaattgatcaaaccagctgatagagttcttttgaagagacgt
atatttgccttgaagagagatggtttgccaccaattgtcactcacaacatggttgatgat
agcaacgatccaattttaaaccatattagaagagttcaattattcaacagatctgaagat
agagtcaagattattttccatccagaattcttgaatgccaataacccaatcttgtccttg
gattatgatgaatttgttcgtggttgtcacttgggtgttttcccatcttattatgaacca
tggggttacactcctgcagaatgtactgttatgggtattccatccatcactaccaacttg
tctggtttcggttgttacatggaagatttgattgaaaacactactgattacggtatctac
attgttgatagaagaatgaaatctgttgatgaatccatcaaccaattgactgattatatg
tatgactttgtcggtaaaaccagacgtcaaagaatcaatcaaagaaaccgtactgaaaga
ttgagtgatcttctcgattggagaagaattggtattgaatatgtcaaggccagaaacttg
gcattaaagagagcttatccagattatgttggtgaaaatattgtcgaatcaaaggtcaaa
ttgactcgtccaatgtctgtcccaggctctccaagatccatgttgttaacccctggtgat
ttgggttcattgcaagaaatggaaatgcaagaagacgctgaatattttgaacttggtgat
ggtgaagaagaagcttga

DBGET integrated database retrieval system