KEGG   Candida tropicalis: CTRG_01521Help
Entry
CTRG_01521        CDS       T01115                                 

Definition
(RefSeq) isocitrate dehydrogenase, mitochondrial precursor
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ctp  Candida tropicalis
Pathway
ctp00020  Citrate cycle (TCA cycle)
ctp00480  Glutathione metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
ctp01210  2-Oxocarboxylic acid metabolism
ctp01230  Biosynthesis of amino acids
ctp04146  Peroxisome
Module
ctp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRG_01521
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CTRG_01521
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    CTRG_01521
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CTRG_01521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 8300735
NCBI-ProteinID: XP_002547215
UniProt: C5M6P0
LinkDB All DBs
Position
Unknown
AA seq 430 aa AA seqDB search
MIRASAIKRTAMLSKQLRSFSTTSSLADKIKVKNPIVELDGDEMTRIIWQKIKDQLVLPY
LDVDLKYYDLGIQSRDATNDQITIDAANAIKEYGVGVKCATITPDEARVKEFNLKKMWLS
PNGTIRNILGGTVFRESIIIPCIPRLIPGWEKPIVIGRHAFGDQYKATDLVINEPGRLEL
RFTPENGGEAQTKKVYDYTGPGVGLAMYNTDESITGFAHASFKMALAKGLPLYMSTKNTI
LKKYDGRFKDIFQQIYEQDYAAEFEKQGLWYEHRLIDDMVAQMIKSKGGFVMALKNYDGD
VQSDIVAQGFGSLGLMTSALMTPDGKAYEAEAAHGTVTRHYRQHQQGKETSTNSIASIFA
WTRGLAQRGKLDETPDVVDFANKLEKATIDTVEVDRIMTKDLALAMGKTDRSAYVTTTEF
LDAVADRLKK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgattagagctagtgctattaaacgtaccgcaatgttactgaaacaattgcgtagtttc
tccaccacatcttctttagccgataagattaaagttaagaatccaattgttgaattagat
ggtgatgaaatgactcgtatcatttggcaaaaaattaaagatcagttagttttaccatac
cttgatgttgatttgaaatattacgatttgggtattcaatcccgtgatgccactaatgat
caaatcaccattgatgctgctaatgctattaaagaatatggtgttggtgttaaatgtgcc
actatcactccagatgaagccagagttaaagaattcaacttgaagaaaatgtggctttca
ccaaatggtactattagaaatattcttggtggtactgttttcagagaatctataattatt
ccatgtattccaagattaattccaggttgggaaaaaccaattgtcattggtagacatgct
tttggtgatcaatataaagctactgatttggttattaatgaaccaggtagattagaatta
agattcactccagaaaatggtggtgaagctcaaactaaaaaagtttatgactacactggt
ccaggtgttggtttagccatgtacaatactgatgaatccatcactggatttgctcatgct
tctttcaaaatggctttagctaaaggtttaccattatatatgtctactaaaaacaccatt
ttgaagaaatacgatggtagattcaaagacattttccaacaaatttatgaacaagattat
gctgctgaatttgaaaaacaaggtttatggtacgaacacagattgattgatgatatggtt
gcacaaatgatcaaatctaagggtggatttgtcatggctcttaagaattacgatggtgat
gttcaatctgatattgttgctcaaggttttggttctttgggtttgatgacttctgctttg
atgaccccagacggtaaagcatatgaggctgaagctgctcatggtactgttactagacat
tacagacaacatcaacaaggtaaagaaacatctaccaactcaattgcttctatttttgca
tggactagaggtttggctcaaagaggtaaattggatgaaaccccagatgttgttgatttt
gctaacaaactcgaaaaagctaccattgatactgttgaagttgatcgtataatgactaaa
gatttggctttagctatgggtaaaactgatagatctgcatatgttaccactactgaattc
ttggatgctgttgctgacagattgaaaaaataa

DBGET integrated database retrieval system