KEGG   Candida tropicalis: CTRG_01682Help
Entry
CTRG_01682        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
ctp  Candida tropicalis
Pathway
ctp00240  Pyrimidine metabolism
ctp00760  Nicotinate and nicotinamide metabolism
ctp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CTRG_01682
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CTRG_01682
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     CTRG_01682
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 8301501
NCBI-ProteinID: XP_002547375
UniProt: C5M750
LinkDB All DBs
Position
Unknown
AA seq 332 aa AA seqDB search
MTKQPIPIWLDCDPGNDDAFAILLSLFDTRFQLLGISTVHGNAPIEMTTHNTLSLLDLLH
VYNKVKVYKGSEAPLKTAPLYALNVHGSNGIGGVEFPENTVNQVVTEKDYLEAMKEAIEA
YSGNICLICTGTLTNVAKLIAKYPEVTESLRYVSIMGGSFGFGNITPYAEFNFRADPYAA
KIVLDTLSNKIILAPLNLTHTVIATKEVRQQIYDANNEKRNSNVRHVFYSIINFYSKVYG
TKGFTEGPPVHDPLAVYSLLPFVDKTDDYGYSFVRKKIDVVVDGERAGESVVSDNDDSSE
GIFIGEQFNKKKFWDSLLLSLQNADFYVASNL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaacccattcccatctggctagattgtgatccaggtaatgacgatgcattt
gcgatattgttatccttgtttgacactaggttccagcttttgggtatttctactgtacat
ggaaatgcccctattgaaatgactacccataatacattgagtttattggatttactacat
gtgtataacaaagtgaaagtttacaaaggatcagaagcaccattaaagactgcaccatta
tatgctttgaatgttcatggtagtaacgggatcggtggcgtggaattccctgagaatacc
gtgaatcaagtggttacagaaaaggactacctcgaggcaatgaaagaggctatcgaagct
tattcaggaaatatttgtttgatttgtactggtacattgacaaatgttgcaaaattaatt
gcaaagtatcctgaagttaccgaaagcttgagatatgtttcaatcatgggcggaagtttt
gggtttggaaatattacaccatatgctgaatttaatttccgtgccgatccttatgcagcc
aaaattgttcttgacactttgagcaataaaataatattggccccattaaatcttacccat
acggtcattgctactaaagaggtcagacaacaaatttatgatgcaaataatgagaaacga
aactcaaatgtaagacacgtgttctattcaataataaatttttattcgaaagtctatggt
acaaagggattcacagaaggtcctcctgtccatgatcccttggctgtttacagtttattg
ccatttgttgataagacagatgattatggctactcgtttgtgagaaagaaaattgatgtt
gttgtggatggggaacgagctggggaatctgtggtactggataatgatgattcaagtgaa
ggtattttcattggagaacaatttaacaagaaaaagttctgggatagtttattattgtct
cttcaaaatgcagatttctacgtggcttctaatttataa

DBGET integrated database retrieval system