KEGG   Candida tropicalis: CTRG_02631Help
Entry
CTRG_02631        CDS       T01115                                 

Definition
(RefSeq) DNA ligase I, mitochondrial precursor
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ctp  Candida tropicalis
Pathway
ctp03030  DNA replication
ctp03410  Base excision repair
ctp03420  Nucleotide excision repair
ctp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CTRG_02631
   03410 Base excision repair
    CTRG_02631
   03420 Nucleotide excision repair
    CTRG_02631
   03430 Mismatch repair
    CTRG_02631
Enzymes [BR:ctp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CTRG_02631
    6.5.1.6  DNA ligase (ATP or NAD+)
     CTRG_02631
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CTRG_02631
DNA replication proteins [BR:ctp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CTRG_02631
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CTRG_02631
DNA repair and recombination proteins [BR:ctp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CTRG_02631
   NER (nucleotide excision repair)
    Other NER factors
     CTRG_02631
   MMR (mismatch exicision repair)
    Other MMR factors
     CTRG_02631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF3220 ORC6
Motif
Other DBs
NCBI-GeneID: 8297354
NCBI-ProteinID: XP_002548334
UniProt: C5M8A9
LinkDB All DBs
Position
Unknown
AA seq 766 aa AA seqDB search
MFRALAIHRTSISNILIKPNQQSLMSNRKQQSLARFFPGMSQSAVSSQNHKKQQSINRYF
GSSSNNSSPTKSQTQKREATPPESSSPSKKPKIGSSSPSADLENDTVAPVSPTTDTTTKL
KHSEDSSRLENEKLIELSEKQKLEHRNENLGPKIPYAKLTSVFEVVDKESSRLKITAIVS
QFFLEILQQSTVDKLVKIVYLSINKLGPDYAQGLELGLGETILIKAISECYGRSPAKIKA
EMVKSGDLGDIAQKSRSMQPPMFKPAPLDIDTVFENLQQIAKSNGKDSQSKKIGLIKKML
SACDPKANEAKFLIRSLAGKLRIGIAEKTLVVGLAQAFVNFENKTNKRINPDKLAEAEEI
VKEAISRVPNYEVVLKKAYEHGIFNLLDHVHVTPGIPLKAMLAKPTKSIGEIFDRFQDAE
FTCEYKYDGFRAQVHVLSDGTVKVYSRNLEDMTETYPDLVSIVNEFTTDKSSVSFILDCE
AVAWDRIQHKILPFQRLTTRKRKDVNEEDITVNICLYAFDLLYFQDESLLTRSLADRRKL
LHEKFKPIDEKFQFATAKDSSSNLEVLQTFLDQSIKDSCEGLMVKMLNGPDSFYEPSKRS
RNWLKLKKDYLAGVGDSLDLVVIGAYSGKGKRTGTYGGFLLASYNQDTGDLETCCKIGTG
FSDEDLASLYKKLHPTEIKTPKKYFVYETNNSNAVPDVWFEPSLLFEVLTADLSLSPIYK
TGHQEFGKGISLRFPRFIRLREDKNIEDATSSTQVCEFYENQASVN
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgagcattggccatccatcgtacttcaatatcaaacattctaattaaaccaaat
caacagtccttgatgtcaaatagaaaacaacaatctttggcacgcttctttccaggcatg
tcccaactggcagtctctagccagaaccacaagaaacaacaatctatcaacaggtacttt
ggatcatcatcaaacaattcaagtccaactaaatcacagacgcaaaagcgtgaagcaacc
ccacctgaatcttcatctccttcaaaaaagcctaaaattgggagctcctcaccttctgcg
gacttggaaaatgacacagtagctccagtttccccaactactgataccacaacaaaactt
aaacatagcgaagatctgtcccgtttagaaaatgaaaagttgattgagctctcagagaaa
cagaaattggaacaccgaaatgaaaatttgggtcctaaaataccttatgcgaaattgaca
tctgtttttgaagttgttgacaaagaatccagtaggttaaaaattactgcaattgtgtcg
cagtttttcttggaaatattgcagcaactgactgtggacaagttggtcaaaattgtttat
ttgtcgataaataaattgggtccagactatgctcagggtttagagttgggtttgggtgag
acaattttaatcaaagccattagcgagtgttacggacgttcaccagcaaaaatcaaggcc
gaaatggtcaaaagtggtgatttgggagatattgctcagaaatctagatcaatgcagcca
cccatgtttaagcctgctccgctagatatagacactgtttttgagaatttgcagcagatt
gcaaaatccaatggtaaggattctcagtcaaaaaagattggtcttatcaaaaaaatgttg
agtgcctgtgatccgaaagccaacgaagcaaaattcttgattcgttctttggcaggtaaa
ttgagaattggtattgcagagaagaccttggttgttggattggctcaagcgtttgtgaac
tttgaaaataaaaccaataaaagaataaatcccgacaaattagctgaagctgaagaaatt
gtcaaagaagccatctctagggttccaaattatgaagttgtgctaaagaaagcttacgaa
catgggatcttcaacttgttggaccatgttcatgttacccctggtattccgctaaaggct
atgttagcaaaacctactaagtcaattggtgagatttttgatcgtttccaagatgctgaa
tttacttgcgaatacaaatatgatggtttcagagctcaagtgcatgttttgagtgatggt
actgtcaaggtttattcacgtaatttggaggatatgacagaaacgtacccagatttggta
tccattgtgaatgaattcactactgataaaagttcagtttcatttattttggattgtgaa
gctgttgcctgggacagaattcagcacaagattttgcctttccaaagattaactaccaga
aagagaaaggatgtgaacgaggaagatatcacggtcaatatttgcttatatgcctttgat
ttgttatattttcaagatgaatctctcttaaccagatcattggcagacagaagaaaacta
ttgcatgaaaagttcaaaccaattgatgaaaaatttcagtttgctactgctaaagattcg
tcgtcaaacttggaagtcttgcagacattcttagatcagtcgatcaaggactcgtgtgaa
gggttgatggttaaaatgttgaacggacctgattcattttacgagccatcaaaaagatcc
cgtaactggttgaaattaaagaaggattaccttgcgggagtaggagattctttggatttg
gttgtcattggtgcctacagtgggaagggtaagagaactggtacctatggtggttttcta
ttggcctcatacaatcaagacacgggtgacttggaaacgtgctgtaaaattggtactggt
ttcagtgatgaagacttggcaagcttgtataaaaaattgcatccaacagaaatcaagaca
cctaagaagtattttgtgtatgaaaccaacaactcgaatgcggttcccgatgtgtggttt
gaacctagtttgctttttgaagtcttgactgctgacttgtctttgagtcctatttacaag
actggacatcaagagtttggtaaaggtatttcgttgaggtttccaagatttattagactt
agagaagacaagaacattgaggacgctactagctcgacgcaagtctgtgagttctatgaa
aaccaagctctggttaattag

DBGET integrated database retrieval system