KEGG   Candida tropicalis: CTRG_03230Help
Entry
CTRG_03230        CDS       T01115                                 

Definition
(RefSeq) repressible alkaline phosphatase precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ctp  Candida tropicalis
Pathway
ctp00730  Thiamine metabolism
ctp00790  Folate biosynthesis
ctp01100  Metabolic pathways
Module
ctp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CTRG_03230
   00790 Folate biosynthesis
    CTRG_03230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ctp04147]
    CTRG_03230
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ctp00537]
    CTRG_03230
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CTRG_03230
Exosome [BR:ctp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CTRG_03230
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ctp00537]
 Enzymes
  CTRG_03230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 8295952
NCBI-ProteinID: XP_002548933
UniProt: C5MAY8
LinkDB All DBs
Position
Unknown
AA seq 555 aa AA seqDB search
MGFTNETQALLGGDSLSCLNKKKSNTKRNLSYFLNIITVSIIAYLCFFSTNNNNKKNAPP
TVDPHKKKNIIMMVTDGMGPASLSAARSFRQFRDKLAINDILTLDQYLIGSSRTRSSSSL
VTDSAAGATAFSCAMKSYNGAIGVASDKSPCGTILEALKLQGYYTGLVVTTRITDATPAA
FSSHVDYRFQEDLIAQHQLGEYPFGRAVDLILGGGRCHFLPASKGGCRGDDRDLIEEYSK
TWQYVGDREQFDQLQGGKNVSLPLLGLIANTDIPYAIDRNETEYPSLAEQVKVALTALSD
ATKDSDQGFFLLIEGSRIDHAGHHNDPAAQVREVLAYDEAFEEVIKFIDSSDVETVAIST
SDHETGGLVVARQVSENYPDYLWYPEVLLNSTHSGDYLAHKIADYKNKDDSTKLTKFIKH
EILENDLGVSDYTDKEVQAILDKANDPANLLYVLNNIVSLRAQIGWTTHGHSAVDVNIYA
HTNSPAIKAKLESARAYHGLTGNHENIEIGAFMEEITGSSLSRVTELIRKTEHSPGSNNN
NNKEVFNADAFHGNI
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgggctttactaacgaaactcaagccttacttggaggcgattccttgtcatgcttgaat
aagaaaaagtccaacaccaagagaaacttatcctactttctcaacatcataactgtatct
atcattgcatatttatgttttttctcaactaataacaacaacaagaagaatgctccacca
acagtagatcctcataagaaaaagaatatcatcatgatggtcacggatggtatgggacct
gccagtttatccgcagccagatcattcagacagttccgtgataaacttgccatcaacgat
attttaactcttgatcagtatcttattggatcttcaagaaccagatcatccagcagtttg
gtgacagattctgctgccggagccactgcattctcatgtgccatgaaatcatacaatggt
gccattggtgttgcctcagataaatccccatgtggtaccattttagaagcattgaagttg
caaggttactatactggtttagttgtgactactagaatcaccgatgccactccagctgca
ttcagttcccacgttgattacagattccaggaagatttgattgcccaacaccaattggga
gagtacccatttggccgtgccgtcgatctcattttgggtggtggtagatgccatttcttg
cctgcctctaaaggcggatgtcgtggtgatgatagagatttgattgaagagtacagcaaa
acatggcaatatgttggcgacagagaacagttcgaccagcttcaaggcggtaaaaatgtc
tccttgccattattgggtttgattgccaataccgacattccatatgctattgatcgtaac
gaaacagaatacccatcgttggcagaacaagtaaaagttgccttgactgcgttgtcagat
gctaccaaggattcggaccaagggtttttcttgctcattgaagggtccagaatcgaccat
gcaggacaccacaacgaccctgctgcccaagttagagaagtgttggcctatgacgaagcg
tttgaagaagtcatcaagttcattgactccagtgatgtggaaactgttgctatttctacc
agtgaccacgaaaccggtggtttggttgttgccagacaagtttctgaaaactatccagat
tacttgtggtatccagaagtgttattgaacagcacccattctggtgattacttggctcac
aagattgcagactacaagaacaaagacgattctactaagctcacaaaattcatcaaacac
gaaattttggaaaatgatttgggagtcagtgactacactgataaagaggtacaagctatt
cttgacaaggccaatgatccagctaacttgttgtatgtgttgaacaatattgtgtccctc
agggcgcaaatcggatggaccacccatggccactctgcagttgatgtcaatatctatgct
cacaccaattcccctgccatcaaagccaaattggaatcagcccgtgcataccatggatta
acaggaaaccatgaaaatattgaaattggtgctttcatggaagaaatcaccggatcaagt
ttgagtcgtgttactgaattgatcagaaaaaccgaacactcaccaggtagcaacaacaac
aacaacaaagaggtgtttaatgctgatgccttccatggtaatatttaa

DBGET integrated database retrieval system