KEGG   Candida tropicalis: CTRG_03472Help
Entry
CTRG_03472        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ctp  Candida tropicalis
Pathway
ctp00250  Alanine, aspartate and glutamate metabolism
ctp00410  beta-Alanine metabolism
ctp00430  Taurine and hypotaurine metabolism
ctp00650  Butanoate metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
Module
ctp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CTRG_03472
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTRG_03472
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CTRG_03472
   00430 Taurine and hypotaurine metabolism
    CTRG_03472
Enzymes [BR:ctp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CTRG_03472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 8297998
NCBI-ProteinID: XP_002549175
UniProt: C5MBN0
LinkDB All DBs
Position
Unknown
AA seq 570 aa AA seqDB search
MVLCKHIDALTLESEILKSTPQAQLQKEQFIDAYDSHTNIPKYEIPSESASSELIYKYLS
QELSLDGNPTLNLASFVNTYADDSSMRLIKDNLTKNLADNDEYPSLIDVETRCITILSNL
WHAPHKVDPATGNKITNSIGTATTGSSEAIMLAGLALKKRWQLKRKAEGKSTENPNILMA
TCAQVALEKFATYFDVENRLIPITSESGHLIDVSKIKENIDENTIGIFVIVGSTFTGAFE
PVEEIANLLDEVEKESGLNIRIHIDGASGGFVAPFIFPHLKWDFANPRVDSISTSGHKFG
LTTVGLGWVIWKDSDLLPKELRFSLDYLGGVEETFGLNFSRPGFPVITQYYNFLTLGRQG
YAEIFNSCMTNARVLAGFYEATGYFEVLSVIHHKLSDSEKKKIYTRKVDETDEKLDCNIY
TINEDYQPGLPVVAFRFSKAIRDKYPELPQELFSSIMRKKGYIIPNYHLPPNENDTELLR
VVVRNTLSLNLLERLIKDSTDVAELLFKAADSVNAIASKKNLETEDEKREEIHRLLAIIS
SAGDVEIRKKQKEEKHTDCGKDKKSYRGTC
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggttttatgtaaacatatcgatgcgttgacattagaatctgagattttaaaatctact
ccacaagctcaattgcaaaaagaacaattcattgatgcttatgattcacatacaaatatt
ccaaaatatgagattccactggaatcagctagttcagaattgatctacaagtacctttct
caagaattgtctcttgatggtaatcctactttgaacttagcatcatttgtcaacacttat
gctgatgattcatcaatgagattgatcaaagataatttgaccaagaatttggctgataat
gatgaatatccaagtttaattgatgttgaaacaagatgtatcaccatcttgagtaacttg
tggcacgccccacataaagttgacccagctactggtaacaagatcaccaactcaattggg
accgccactactggttcttctgaagctatcatgttggcaggtttggcattgaagaagaga
tggcaattgaaaagaaaagccgaaggtaaatcaactgagaacccaaacattttaatggcc
acctgtgctcaagttgcattggaaaaatttgcaacttattttgacgttgaaaatagattg
attccaatcacttctgaatctggacatttaattgatgttagtaagattaaagaaaacatt
gatgagaataccattggtatttttgttattgttggatctacatttactggagcattcgaa
ccagttgaagaaattgcaaatttattagatgaggttgaaaaagaatcaggtttaaatatt
agaattcatattgatggagcatctggtggatttgtagcaccttttattttcccacattta
aaatgggattttgctaatcctagagttgattcaataagtacatctggtcataaatttgga
ttaactacagttggtttaggttgggtaatttggaaagattctgatttattacctaaggaa
ttacgtttcagtttagattatttgggtggtgttgaagaaacttttggtttgaatttctca
agacctggattcccagttattactcaatattataatttcttaactttgggcagacaaggt
tatgctgaaattttcaatagttgtatgactaatgcaagagttttagctgggttttatgaa
gctactggatattttgaagtcctttcagttattcatcataaattgtctgactcagaaaag
aagaaaatttatactagaaaagttgatgaaactgatgaaaaattagattgtaatatttat
acaataaatgaggattatcaaccagggttaccagttgttgcatttagattttcaaaagct
attagggataaatatcctgaattaccacaagaattattttcttcaatcatgagaaagaaa
ggttatatcattccaaattatcatttaccaccaaatgaaaacgatactgaattattaaga
gttgtggttagaaatactttatctttgaatttattagaaagattaattaaagattcaact
gatgtagctgaattattatttaaagctgctgattcagttaatgctattgcatcaaagaaa
aacctcgaaaccgaagatgaaaagagagaagaaatccatcgccttttggctatcatttca
tccgcaggcgatgttgaaatcagaaagaagcaaaaggaagaaaaacacactgattgtgga
aaggataaaaaatcatatagaggtacttgttaa

DBGET integrated database retrieval system