KEGG   Candida tropicalis: CTRG_04027Help
Entry
CTRG_04027        CDS       T01115                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ctp  Candida tropicalis
Pathway
ctp00020  Citrate cycle (TCA cycle)
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
Module
ctp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRG_04027
  09105 Amino acid metabolism
   00310 Lysine degradation
    CTRG_04027
   00380 Tryptophan metabolism
    CTRG_04027
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CTRG_04027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N BioY
Motif
Other DBs
NCBI-GeneID: 8297005
NCBI-ProteinID: XP_002549730
UniProt: C5MCS6
LinkDB All DBs
Position
Unknown
AA seq 995 aa AA seqDB search
MLTAFRNAVPRAQLLKVNIPKTTYTQLSKRFLATDSFLQGNNSTYVDEMYDAWRHDPSSV
HASWNAYFKNIENDNVPPSKAFQAPPTIVPTVSGGAAGFYPGQSPISEDVVTHLKVQLLV
RAYQVRGHQKAKIDPLGISFGDNATVPRELTLEYYGFTDKDLDKEITLGPGILHRFTQDG
KKSMTLREIIDTCEQTYCSSYGVEYVHIPSKEKCDWLRDRIEVPQPYKYSPDQKRQILDR
LIWATSFEAFLSSKFPNDKRFGLEGAEAVVPGMKSLIDTSVEYGVEDVVIGMPHRGRLNM
LSNVVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYARPTTSGKHVNLSIVANPSHLEA
EDGVVLGKTRAIQQYKNDIGNFKKAMAVLLHGDAAFAAQGVVYETMGFASLPAYSTGGTI
HVIVNNQIGFTTDPRFARSTLYPSDIAKSIDAPIFHVNADDVEACTFVFNLAAEWRATFH
TDCIIDVVGYRKYGHNETDQPSFTQPLMYQEIAKKKSVIDIYEKQLINEGTFTAEDIQEH
KKWVWDVLEDNFKKAKDYKPTSREWLTTPWEDFKSPRELATEVLPHLPTAVDEGILKKIG
KAISETPEGFEVHRNLKRILNARKKSVETGEGIDYATGEALAYGSLALEGYHVRVSGQDV
ERGTFSQRHAVLHDQNSESTWTPLSNLAEDQGAFNISNSSLSEYGVLGFEYGYSLTSPDA
LVEWEAQFGDFANTAQVVIDQFVAGAESKWKQRSGVVLSLPHGYDGQGPEHSSARIERYL
QLCNEDQRYFPSPEKLERQHQDCNMQVAYPTTPANIFHLLRRQMHREFRKPLIVIFSKSL
LRHPLARSNLSEFTGDSHFQWIIEDVLGEKSEVKRVVLLSGQVYAALHKKRAALEDKTTA
FIKVEQLHPFPYAQLRDALNEYPNIEDLVWTQEEPLNMGAYNYVAPRIEAVLQETENYKD
LKLRYAGRDPSASVAAGSKSMHVAEEEEIIAQTFQ
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgcttactgctttcagaaatgctgttcctcgtgctcagcttttgaaggtaaatattcca
aaaaccacttatactcaattgagtaaacgtttcctcgctaccgactcatttttacaagga
aacaactccacctatgttgatgaaatgtacgatgcctggagacacgatccttccagtgtc
catgcttcttggaatgcttacttcaagaacattgaaaacgacaatgtcccaccatcaaag
gctttccaagctccaccaaccattgttcctactgtttctggaggtgccgccggattttac
cctggtcaaagtccaatttctgaagacgttgtcacccacttgaaggttcaattattggta
cgtgcttaccaagttagaggacaccaaaaggcaaaaattgatccattgggaatttccttt
ggtgacaatgctactgttcctagagaattgactttagaatactatggttttaccgacaaa
gatttagacaaagaaatcaccttgggtcctggtattttgcatagatttacccaagatggt
aaaaagagcatgactttaagagaaatcattgacacctgtgaacaaacatactgttcttct
tatggtgttgaatatgttcatattccatctaaggaaaaatgtgattggttgagagacaga
attgaagttcctcaaccttacaagtattctccagaccaaaagagacaaattttggatcgt
ttgatttgggccacctcctttgaagcctttttgtcctccaagttccctaacgacaagaga
tttggtttggaaggtgccgaagccgttgttccaggtatgaaatcattaattgatacttct
gtcgaatacggtgtcgaagatgttgtcattggtatgccacacagaggtagattgaatatg
ttgtccaatgttgttcgtaaaccaaacgaatccatcttttctgaattcactggttccaaa
gaatttgatgaaggttctggtgatgttaaataccatttgggtatgaactatgctagacca
accacatccggtaaacacgtcaacttgtctattgttgctaacccatcccatttggaagcc
gaagatggtgtcgttttaggtaagacccgtgccatccaacaatacaagaatgatattggt
aacttcaagaaggccatggctgttcttttgcatggtgatgccgcttttgctgcccaaggt
gttgtttatgaaaccatgggtttcgctagtttgccagcttactccactggtggtactatc
catgttattgtcaacaatcaaatcggtttcactaccgatccaagatttgccagatctact
ttgtacccatctgatattgctaaatcaattgatgccccaattttccacgttaatgctgac
gatgttgaagcttgtacttttgttttcaacttggcagctgaatggagagccactttccac
actgattgtattattgatgttgttggttacagaaagtacggtcataatgaaaccgatcaa
ccatctttcactcaaccactcatgtaccaagaaattgccaagaagaaatctgtcattgac
atttacgaaaaacaattgatcaacgaaggtactttcactgctgaagatatccaagaacac
aagaaatgggtctgggacgtcttggaagataacttcaagaaagctaaagattataaacca
acttctagagaatggttaaccactccttgggaagatttcaagtctccaagagaattggcc
accgaagttttaccacacttgccaactgccgttgacgaaggtatcttgaaaaagattggt
aaagctatttctgaaaccccagaaggttttgaagtgcatagaaacttgaaacgtatcttg
aatgctagaaagaagagtgttgaaaccggtgaaggtattgactatgccactggtgaagct
cttgcttatggttctttagcccttgaaggttaccacgtcagagtttctggtcaagatgtt
gaaagaggtactttttcacaaagacacgctgttttacatgaccaaaacagtgaatccacc
tggaccccattgtctaacttggctgaagatcaaggtgctttcaacatttccaactcttct
ttgtctgaatatggtgttttaggtttcgaatatggttactccttgacttccccagatgct
ttggttgaatgggaagcccaatttggtgattttgccaatactgctcaagttgttattgat
caatttgttgctggtgccgaatctaaatggaaacaaagatctggtgttgttttgtccttg
ccacatggttacgatggtcaaggtccggaacattcttctgccagaattgaaagatacttg
caattgtgtaacgaagatcaacgttatttcccatctccagaaaaattagaacgtcaacac
caagattgtaacatgcaagttgcttacccaaccacccctgccaatattttccatcttttg
cgtcgtcaaatgcacagagaattcagaaagccattgattgtcattttctccaagtcattg
ttgcgtcatccattggccagatccaatttatctgaattcactggtgattcacacttccaa
tggatcattgaagatgttttgggtgaaaaatctgaagttaagagagttgttttgttgtct
ggtcaagtttacgctgctttgcacaagaagagagctgctttggaagacaagaccactgca
ttcatcaaggttgaacaattgcatccattcccatatgctcaattacgtgatgcattgaac
gaatatccaaacattgaagatttggtttggactcaagaagaaccattgaacatgggtgct
tacaactatgttgctccaagaattgaagctgtcttacaagaaactgaaaattacaaagat
ttgaaattaagatacgctggtagagacccaagtgcttctgttgctgctggttctaaatcc
atgcatgttgccgaagaagaagaaatcattgcccaaacttttcaataa

DBGET integrated database retrieval system