KEGG   Candida tropicalis: CTRG_04027Help
Entry
CTRG_04027        CDS       T01115                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component, mitochondrial precursor
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ctp  Candida tropicalis
Pathway
ctp00020  Citrate cycle (TCA cycle)
ctp00310  Lysine degradation
ctp00380  Tryptophan metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
Module
ctp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRG_04027
  09105 Amino acid metabolism
   00310 Lysine degradation
    CTRG_04027
   00380 Tryptophan metabolism
    CTRG_04027
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CTRG_04027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N BioY
Motif
Other DBs
NCBI-GeneID: 8297005
NCBI-ProteinID: XP_002549730
UniProt: C5MCS6
LinkDB All DBs
Position
Unknown
AA seq 995 aa AA seqDB search
MLTAFRNAVPRAQLLKVNIPKTTYTQLSKRFLATDSFLQGNNSTYVDEMYDAWRHDPSSV
HASWNAYFKNIENDNVPPSKAFQAPPTIVPTVSGGAAGFYPGQSPISEDVVTHLKVQLLV
RAYQVRGHQKAKIDPLGISFGDNATVPRELTLEYYGFTDKDLDKEITLGPGILHRFTQDG
KKSMTLREIIDTCEQTYCSSYGVEYVHIPSKEKCDWLRDRIEVPQPYKYSPDQKRQILDR
LIWATSFEAFLSSKFPNDKRFGLEGAEAVVPGMKSLIDTSVEYGVEDVVIGMPHRGRLNM
LSNVVRKPNESIFSEFTGSKEFDEGSGDVKYHLGMNYARPTTSGKHVNLSIVANPSHLEA
EDGVVLGKTRAIQQYKNDIGNFKKAMAVLLHGDAAFAAQGVVYETMGFASLPAYSTGGTI
HVIVNNQIGFTTDPRFARSTLYPSDIAKSIDAPIFHVNADDVEACTFVFNLAAEWRATFH
TDCIIDVVGYRKYGHNETDQPSFTQPLMYQEIAKKKSVIDIYEKQLINEGTFTAEDIQEH
KKWVWDVLEDNFKKAKDYKPTSREWLTTPWEDFKSPRELATEVLPHLPTAVDEGILKKIG
KAISETPEGFEVHRNLKRILNARKKSVETGEGIDYATGEALAYGSLALEGYHVRVSGQDV
ERGTFSQRHAVLHDQNSESTWTPLSNLAEDQGAFNISNSSLSEYGVLGFEYGYSLTSPDA
LVEWEAQFGDFANTAQVVIDQFVAGAESKWKQRSGVVLSLPHGYDGQGPEHSSARIERYL
QLCNEDQRYFPSPEKLERQHQDCNMQVAYPTTPANIFHLLRRQMHREFRKPLIVIFSKSL
LRHPLARSNLSEFTGDSHFQWIIEDVLGEKSEVKRVVLLSGQVYAALHKKRAALEDKTTA
FIKVEQLHPFPYAQLRDALNEYPNIEDLVWTQEEPLNMGAYNYVAPRIEAVLQETENYKD
LKLRYAGRDPSASVAAGSKSMHVAEEEEIIAQTFQ
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atgcttactgctttcagaaatgctgttcctcgtgctcagcttttgaaggtaaatattcca
aaaaccacttatactcaattgagtaaacgtttcctcgctaccgactcatttttacaagga
aacaactccacctatgttgatgaaatgtacgatgcctggagacacgatccttccagtgtc
catgcttcttggaatgcttacttcaagaacattgaaaacgacaatgtcccaccatcaaag
gctttccaagctccaccaaccattgttcctactgtttctggaggtgccgccggattttac
cctggtcaaagtccaatttctgaagacgttgtcacccacttgaaggttcaattattggta
cgtgcttaccaagttagaggacaccaaaaggcaaaaattgatccattgggaatttccttt
ggtgacaatgctactgttcctagagaattgactttagaatactatggttttaccgacaaa
gatttagacaaagaaatcaccttgggtcctggtattttgcatagatttacccaagatggt
aaaaagagcatgactttaagagaaatcattgacacctgtgaacaaacatactgttcttct
tatggtgttgaatatgttcatattccatctaaggaaaaatgtgattggttgagagacaga
attgaagttcctcaaccttacaagtattctccagaccaaaagagacaaattttggatcgt
ttgatttgggccacctcctttgaagcctttttgtcctccaagttccctaacgacaagaga
tttggtttggaaggtgccgaagccgttgttccaggtatgaaatcattaattgatacttct
gtcgaatacggtgtcgaagatgttgtcattggtatgccacacagaggtagattgaatatg
ttgtccaatgttgttcgtaaaccaaacgaatccatcttttctgaattcactggttccaaa
gaatttgatgaaggttctggtgatgttaaataccatttgggtatgaactatgctagacca
accacatccggtaaacacgtcaacttgtctattgttgctaacccatcccatttggaagcc
gaagatggtgtcgttttaggtaagacccgtgccatccaacaatacaagaatgatattggt
aacttcaagaaggccatggctgttcttttgcatggtgatgccgcttttgctgcccaaggt
gttgtttatgaaaccatgggtttcgctagtttgccagcttactccactggtggtactatc
catgttattgtcaacaatcaaatcggtttcactaccgatccaagatttgccagatctact
ttgtacccatctgatattgctaaatcaattgatgccccaattttccacgttaatgctgac
gatgttgaagcttgtacttttgttttcaacttggcagctgaatggagagccactttccac
actgattgtattattgatgttgttggttacagaaagtacggtcataatgaaaccgatcaa
ccatctttcactcaaccactcatgtaccaagaaattgccaagaagaaatctgtcattgac
atttacgaaaaacaattgatcaacgaaggtactttcactgctgaagatatccaagaacac
aagaaatgggtctgggacgtcttggaagataacttcaagaaagctaaagattataaacca
acttctagagaatggttaaccactccttgggaagatttcaagtctccaagagaattggcc
accgaagttttaccacacttgccaactgccgttgacgaaggtatcttgaaaaagattggt
aaagctatttctgaaaccccagaaggttttgaagtgcatagaaacttgaaacgtatcttg
aatgctagaaagaagagtgttgaaaccggtgaaggtattgactatgccactggtgaagct
cttgcttatggttctttagcccttgaaggttaccacgtcagagtttctggtcaagatgtt
gaaagaggtactttttcacaaagacacgctgttttacatgaccaaaacagtgaatccacc
tggaccccattgtctaacttggctgaagatcaaggtgctttcaacatttccaactcttct
ttgtctgaatatggtgttttaggtttcgaatatggttactccttgacttccccagatgct
ttggttgaatgggaagcccaatttggtgattttgccaatactgctcaagttgttattgat
caatttgttgctggtgccgaatctaaatggaaacaaagatctggtgttgttttgtccttg
ccacatggttacgatggtcaaggtccggaacattcttctgccagaattgaaagatacttg
caattgtgtaacgaagatcaacgttatttcccatctccagaaaaattagaacgtcaacac
caagattgtaacatgcaagttgcttacccaaccacccctgccaatattttccatcttttg
cgtcgtcaaatgcacagagaattcagaaagccattgattgtcattttctccaagtcattg
ttgcgtcatccattggccagatccaatttatctgaattcactggtgattcacacttccaa
tggatcattgaagatgttttgggtgaaaaatctgaagttaagagagttgttttgttgtct
ggtcaagtttacgctgctttgcacaagaagagagctgctttggaagacaagaccactgca
ttcatcaaggttgaacaattgcatccattcccatatgctcaattacgtgatgcattgaac
gaatatccaaacattgaagatttggtttggactcaagaagaaccattgaacatgggtgct
tacaactatgttgctccaagaattgaagctgtcttacaagaaactgaaaattacaaagat
ttgaaattaagatacgctggtagagacccaagtgcttctgttgctgctggttctaaatcc
atgcatgttgccgaagaagaagaaatcattgcccaaacttttcaataa

DBGET integrated database retrieval system