KEGG   Candida tropicalis: CTRG_04515Help
Entry
CTRG_04515        CDS       T01115                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit, mitochondrial precursor
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ctp  Candida tropicalis
Pathway
ctp00020  Citrate cycle (TCA cycle)
ctp00190  Oxidative phosphorylation
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
Module
ctp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ctp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRG_04515
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CTRG_04515
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CTRG_04515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 HI0933_like FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 8299884
NCBI-ProteinID: XP_002550217
UniProt: C5MEM2
LinkDB All DBs
Position
Unknown
AA seq 639 aa AA seqDB search
MLISRNARRITSLPRRLFTTSTTCCQTIGSIKGSELNTSKYLQQKYVVIDHEYDCIVVGA
GGAGLRAAFGLAESGYKTACISKLFPTRSHTVAAQGGINAALGNMHRDDWHWHFYDTVKG
SDWLGDQDAIHYMTKEAPDSIYELEHYGVPFSRNEEGRIYQRAFGGQTKEFGKGGQAYRT
CAVADRTGHALLHSLYGQALRHNCHFFIEFFAMDLLMQDGECVGVIAYNQEDGTLHRFRA
HKTVIATGGYGRAYFSCTSAHTCTGDGYAMAARAGLPLQDLEFIQFHPSGIYGSGCLITE
GARGEGGFLVNSEGERFMERYAPSAKDLACRDVVSRAITMEINEGRGVGPEKDHMYLQLN
HLPAAVLKERLPGISETAHIFAGVDVTKEPIPILPTVHYNMGGIPTNWKGEVLKMGPDGK
DEVVPGLLACGEAACASVHGANRLGANSLLDLVVFGRAVSHTIRDTLTPNAPLHPSPADL
GKQSIENLHHLRTAAGTKPTAEIRLDMQKTMQSGCAVFRTEETLNKCVDHMTKVNKSFED
IKTTDRSMIWNSDLVETMELQNLLTCATQTAVSAAARKESRGSHSREDYPDRDDVNWWKH
TLSYQKDVNDPVKLDYRDVIKTTLDDGDCKPVPPTVRRY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgttaatttcgagaaacgcaagaagaattacgtctttacctcgacgtttgtttactaca
tctactacttgttgtcaaacaattggttccatcaaaggttctgagctaaacacttctaaa
tatttgcaacaaaagtatgttgtcattgaccatgaatatgattgtatcgtggtaggagca
ggaggagcaggattacgagcagcatttgggttagctgaatctggatataaaacagcatgt
ataagtaaattatttcccacaagatcccatactgttgctgcacaaggaggtatcaatgcc
gcattaggaaacatgcatcgagatgactggcactggcatttttatgatacagtcaaggga
tctgactggttaggtgatcaagatgccatacattatatgacaaaagaggcgcctgattct
atttatgagttagaacattatggtgttccattttcaagaaatgaagaaggaagaatatat
caaagagcatttgggggtcagaccaaagaattcggtaaaggtggtcaagcttatagaact
tgtgccgttgctgatagaacaggtcatgcattgttgcattctttatatggacaggcattg
agacataattgccattttttcattgaattctttgctatggatttacttatgcaagatgga
gaatgtgttggtgtcattgcttataaccaagaagatggtactttgcaccgattcagagct
cacaagacagttattgctactggaggttatggaagggcatatttttcctgtacatcggcc
cacacatgtactggtgatgggtatgcaatggctgcaagagccggtttgccattacaagat
ttagaattcattcaatttcacccatcaggtatctatggatcaggttgtcttattaccgag
ggtgctagaggtgaaggtgggtttttagtcaactcagaaggtgaaagatttatggaaaga
tatgccccatctgctaaagatttagcatgcagggatgttgtttcaagagctattactatg
gaaatcaacgaaggtaggggtgttggtcctgaaaaagatcacatgtatttgcaattaaac
catttacccgctgcagtgttgaaagaacgtttaccaggtatttctgagactgcacacatt
tttgcaggtgttgatgttacgaaagagccaattccaattctacctactgtgcattataat
atgggtggtattccaacaaactggaaaggtgaagtattaaaaatgggtccagatggtaaa
gatgaggttgttccagggttattggcttgtggtgaagccgcatgtgcttctgtccatggg
gccaatagattgggggctaattcgttattagatttagttgtatttggaagagctgtttct
cataccatcagagacacattgactccgaatgcacctttacatccttctcctgctgatctt
ggtaagcaatcaattgaaaacttgcatcatttgagaactgccgctggcactaaaccaacg
gctgaaattagattagatatgcaaaaaaccatgcaaagtggatgtgctgtatttagaacc
gaagaaactttgaacaaatgtgttgatcatatgacaaaggtaaataaatcatttgaagat
atcaagacgactgatcgttcaatgatttggaactccgatttggttgagaccatggaatta
cagaatttattaacatgtgccacacaaactgcagtatctgcagctgctagaaaagaatca
aggggttcacattcaagagaggattacccagatagagatgacgttaactggtggaagcat
actttatcctaccaaaaagatgtgaacgacccggttaagttggattacagagacgtaatc
aagaccacattagatgatggggattgtaaaccagttcctccaactgttcgtaggtactag

DBGET integrated database retrieval system