KEGG   Candida tropicalis: CTRG_06083Help
Entry
CTRG_06083        CDS       T01115                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ctp  Candida tropicalis
Pathway
ctp00052  Galactose metabolism
ctp00500  Starch and sucrose metabolism
ctp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CTRG_06083
   00500 Starch and sucrose metabolism
    CTRG_06083
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CTRG_06083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-GeneID: 8298732
NCBI-ProteinID: XP_002546605
UniProt: C5MJ40
LinkDB All DBs
Position
Unknown
AA seq 575 aa AA seqDB search
MTIDYTWWKDATVYQIWPASFKDSNGDGIGDIPGIITELDYLKDLGVDIIWLSPMYKSPM
EDMGYDISDYEDINPDFGTLQDMQNLIDGCHERGMKIICDSVLNHTSAEHEWFKESRSSL
DNPKRDWYIWKKPKYDADGNRQPPNNWLSYFSGSAWTYDEKTGEYYLRLFANGQPDLNWE
NEECRKAIYDSALKFWLDRGVDGFRIDTAGLYSKHQSFGDAPIVFKDSIYQPSEKYTHTG
PRIHEFHQEMNKEVWSKYDIMTVGEVGHCKREEALKYVSAARKEMNMMFLFDIVELGSDD
QDRFRYLGWKLKDFKEAIQIQSDFIKGTDAWSTVFIENHDNARCISRFGDDRKYSAKSGK
LLATLQATLTGTLFIYQGQEIGMTNLPRSWPIEEYKDINTINYYNAFKEKCGNDPDFKEK
EEKLLDVINLVARDHARSPVQWNSSANAGFTSGKPWMRVNDNYKEINVEAQQKDPNSVLQ
FYERLLKLRKEYKDLFIYGSFEILDYDNEKTFTYVKELQNADSPKAYVVLNMSGDQVKFN
PLIKGDFRLIVSNVSQSELVENTLTPWEARVYIVD
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgactattgactatacttggtggaaagatgccactgtttatcaaatctggccagcttct
tttaaggattcaaacggtgacggtattggtgatattcctggtattattactgaattggac
tacctcaaggatttaggagttgatattatctggttgagtccaatgtacaaatctccaatg
gaagatatgggttatgatatcagtgattatgaagacatcaacccagacttcggtactttg
caagatatgcaaaatttaattgatggttgccacgaaagaggcatgaaaatcatctgtgac
ctggttcttaatcatacttctgctgaacatgaatggtttaaagaatcgagatcttcattg
gacaacccaaagagagactggtatatctggaagaaaccaaaatatgatgctgatggtaac
agacaaccaccaaacaactggttatcttatttctctggttccgcatggacttatgatgaa
aaaactggtgaatattatttaagattatttgctaatggtcaacctgatttgaactgggag
aatgaagaatgtagaaaagcaatttatgattctgcattgaaattttggttagacagagga
gttgatggtttcagaattgatactgctggtttgtattccaaacatcaatcatttggcgat
gctccaattgtctttaaagatctgatttatcaaccaagtgaaaagtatactcatacgggt
ccaagaatccacgaattccatcaagaaatgaacaaagaagtttggtctaaatatgatatt
atgaccgttggtgaggttggtcattgtaagagagaagaagcattgaaatatgtgagcgct
gctagaaaagaaatgaatatgatgtttttatttgatattgttgaattaggtagtgatgac
caagatagattcagatacttgggttggaaattgaaggatttcaaagaagccattcaaatt
caaagcgatttcattaaaggtactgatgcttggtcaactgttttcattgagaaccatgat
aatgctagatgcatttcgagatttggtgatgacagaaaatacagtgctaaaagtggtaaa
ttattggccactttacaagctactttgactggtactttgtttatctaccaaggtcaagaa
atcggaatgaccaatttaccaagatcatggccaattgaagaatacaaggatatcaacacc
atcaactactacaatgctttcaaggaaaaatgtggtaatgatccagatttcaaagaaaag
gaagagaaattattagacgttatcaacttagttgctagagatcatgctagatctccagtc
caatggaattcttcagccaatgccggttttacttcaggtaaaccatggatgagagttaat
gacaactataaagaaatcaatgttgaagctcaacaaaaggatccaaattcagtattgcaa
ttttatgaaagattattgaaattaagaaaagaatacaaggatttgttcatttatggatca
tttgaaattttagattatgataatgaaaaaactttcacctatgttaaagaattacaaaat
gctgattcaccaaaagcttatgttgttctcaacatgtctggtgatcaagttaaatttaac
ccattgattaaaggtgatttcagattaattgtttccaacgtttctcaatcagaattagtt
gaaaacactttaacaccatgggaagccagagtttacattgttgattaa

DBGET integrated database retrieval system