KEGG   Chlamydia trachomatis D/UW-3/CX: CT_844
Entry
CT_844            CDS       T00017                                 
Symbol
yfhC
Name
(RefSeq) nucleoside deaminase
  KO
K11991  tRNA(adenine34) deaminase [EC:3.5.4.33]
Organism
ctr  Chlamydia trachomatis D/UW-3/CX
Brite
KEGG Orthology (KO) [BR:ctr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ctr03016]
    CT_844 (yfhC)
Enzymes [BR:ctr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.33  tRNA(adenine34) deaminase
     CT_844 (yfhC)
Transfer RNA biogenesis [BR:ctr03016]
 Prokaryotic type
  tRNA modification factors
   Deaminases
    CT_844 (yfhC)
SSDB
Motif
Pfam: MafB19-deam dCMP_cyt_deam_1 SNAD4 Inv-AAD Bd3614-deam APOBEC2
Other DBs
NCBI-GeneID: 884202
NCBI-ProteinID: NP_220365
UniProt: O84851
LinkDB
Position
995570..996061
AA seq 163 aa
MCIEKDLFFMKKALDEARKAYEQDEVPVGCIIVHGDKIIARGHNSVEQLKDPTVHAEMIC
ISAAAEYLENWRLKDTILYCTLEPCLMCAGAIQLARIPRIVWGAPDLRLGAGGSWLNVFL
EKHPFHQVECCSGVCYQESEQLMKNFFLEKRKAKDEGRNSRAT
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtgtatagaaaaagatttatttttcatgaagaaggctctagatgaggctaggaaggca
tatgaacaagatgaagtccctgttggttgtatcatcgttcatggagataagatcatcgct
agaggacataatagtgttgagcaattaaaagatccgacagtacatgctgaaatgatttgt
attagtgcagcagcagaatatctagagaattggagattgaaagacacgatcctctactgt
actttagagccctgtctcatgtgtgctggagcgattcagttagcacgtattcctagaatt
gtttggggggctcctgatttgcgtttaggagctggagggagttggttaaatgttttttta
gaaaaacatcctttccatcaagtagagtgttgttctggtgtttgttaccaagagtctgag
cagttaatgaaaaacttttttttagagaagagaaaggctaaggatgaaggaagaaattct
cgcgctacttga

DBGET integrated database retrieval system