KEGG   Chlamydia trachomatis K/SotonK1: SOTONK1_00210Help
Entry
SOTONK1_00210     CDS       T02546                                 

Definition
(GenBank) diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctrk  Chlamydia trachomatis K/SotonK1
Pathway
ctrk00010  Glycolysis / Gluconeogenesis
ctrk00030  Pentose phosphate pathway
ctrk00051  Fructose and mannose metabolism
ctrk00680  Methane metabolism
ctrk01100  Metabolic pathways
ctrk01110  Biosynthesis of secondary metabolites
ctrk01120  Microbial metabolism in diverse environments
ctrk01130  Biosynthesis of antibiotics
ctrk01200  Carbon metabolism
ctrk01230  Biosynthesis of amino acids
ctrk03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ctrk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SOTONK1_00210
   00030 Pentose phosphate pathway
    SOTONK1_00210
   00051 Fructose and mannose metabolism
    SOTONK1_00210
   00052 Galactose metabolism
    SOTONK1_00210
  09102 Energy metabolism
   00680 Methane metabolism
    SOTONK1_00210
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SOTONK1_00210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ctrk01009]
    SOTONK1_00210
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ctrk03019]
    SOTONK1_00210
Enzymes [BR:ctrk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SOTONK1_00210
Protein phosphatases and associated proteins [BR:ctrk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SOTONK1_00210
Messenger RNA biogenesis [BR:ctrk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SOTONK1_00210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: CCP50369
LinkDB All DBs
Position
230722..232383
Genome map
AA seq 553 aa AA seqDB search
MSSNKHASLCQKTPSLCRELQKAPALLLTEDIRFKALLNERIDSVAELFPCTYNSPYYKF
ISKSDLSAETSPLKVGVMLSGGPAPGGHNVILGLLHSIKKLHPNSQLLGFIRNGEGLLNN
NTVEITDEFIEEFRNSGGFNCIGTGRTNIITEENKARCLQTANELDLDGLVIIGGDGSNT
ATAILAEYFAKHQAKTVLVGVPKTIDGDLQHLFLDLTFGFDTATKFYSSIISNISRDALS
CKGHYHFIKLMGRSSSHITLECALQTHPNIALIGEEIAEKSISLETLIHDICETIADRAA
MGKYHGVILIPEGVIEFIPEIQSLVKEIESIPEQENLYQALSLSSQQLLCQFPEDICHQL
LYNRDAHGNVYVSKISVDKLLIHLVRQHLETHFRQVPFNAISHFLGYEGRSGTPTHFDNV
YSYNLGYGAGVLVFNRCNGYLSTIEGLTSPIEKWRLRALPIVRMLTTKQGKDSKHYPLIK
KRLVDIASPVFNKFSLYRKIWALEDSYRFVGPLQIHSPEDAHSDDFPPLILFLNHNEWQK
RCSICLEIPDQDY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgaataaacatgcttctctttgtcaaaagacgccttctttgtgtcgggagctt
caaaaagctcctgctcttctattaacagaagacataaggtttaaagctcttcttaatgaa
cgcattgactctgttgcagaactatttccatgcacttataactctccctactacaaattt
atttcgaagtccgatctttccgctgagacctctccccttaaagtgggcgttatgctttct
ggaggcccagctcctggtgggcacaatgtcatcttaggattgctacacagtattaaaaag
ctccatccgaatagtcagcttttaggatttattcgcaatggagaaggacttctcaataat
aatactgtagaaatcacagatgaattcattgaagagtttcgtaactctggaggctttaat
tgcataggaacaggtcgcactaatatcataaccgaagaaaataaagcgcgctgtttacaa
acagcaaatgaactcgatttagatggattagtgattattggaggcgatggttcgaataca
gccacggcgattcttgctgaatattttgctaagcatcaagcaaaaacggtattagttggt
gttcccaaaactattgatggagatttgcagcacctatttttagacctcacatttgggttt
gatactgctactaaattttattcatccatcatcagcaacatttctagagacgcattatcg
tgtaaaggccactatcattttattaaactaatgggccggtcttcttctcatatcacgcta
gaatgcgcactacagactcacccaaatattgctcttataggcgaagagattgcagaaaaa
agcatctccttagaaacattaatccatgatatttgtgaaacaatagcagatcgagctgct
atggggaaataccatggcgttattctcatccctgaaggagtcattgagtttattcctgaa
atacagtctctggttaaagaaattgaatccattccagagcaggagaatctttaccaagct
ttatccttatcttctcagcaacttttatgccaatttccggaagatatttgccatcagctc
ttgtataatagagatgctcatggcaacgtctatgtatcaaaaattagtgttgataaactt
ctgattcatctagttcgtcaacatttagaaacacattttagacaagttcccttcaatgca
atctcccattttttaggttatgaagggcgttcaggaactcctacacattttgataatgtg
tatagctataacttaggatatggtgctggggttctcgtttttaaccgctgtaatgggtat
ttatccacgatcgaaggtctaactagccctattgaaaaatggcgattgcgcgctttaccc
attgttcgaatgttgacgaccaagcaggggaaagacagtaaacattatcctctgataaaa
aaaagattggtagatattgctagtcctgtttttaataagttctcactgtatcggaaaatc
tgggctttagaagactcctatcgctttgtagggccattacaaatacattctccggaggat
gctcattctgatgattttcctcctttaattttgtttttgaatcataatgaatggcaaaaa
cgctgttctatttgtttagaaatccccgatcaggattattaa

DBGET integrated database retrieval system