KEGG   Chlamydia trachomatis L3/404/LN: L3404_00134Help
Entry
L3404_00134       CDS       T02550                                 

Definition
(GenBank) hypothetical protein
  KO
K07058  membrane protein
Organism
ctrn  Chlamydia trachomatis L3/404/LN
Brite
KEGG Orthology (KO) [BR:ctrn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    L3404_00134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB MarR HTH_24
Motif
Other DBs
NCBI-ProteinID: CCP66617
LinkDB All DBs
Position
complement(149853..151130)
Genome map
AA seq 425 aa AA seqDB search
MLRPPSFLKKLLSSVRNNFIIKSILKAPKVLYHNGASKEACVLSYYGLFSCVPILVFFLR
LSQYLFISLDWKEWLLLHFPDYKAPILAIIEAAYSTTSNIGVVLVSSFFVFCWAGILMLQ
SLEDGLNKIFCSGITQASLKRLISYLVITLVSPMIFIIVCGSWIYITQILPINYPQLFSF
SHSMAFIYIVSRLLPYALLYGILFCCYAFLSRVPTKKSAAFFAATIAGSAWILSQKIFFC
LQLHLFNYSFTYGALVALPSFLLLLYLYAIIYLFGGALTFLFQNKGFSILIPKEEIFPSS
YFKFILCVYVLSLITEHFDNALPPPSANYLANKAKASIGETSQCLDILEREGMILKYKEG
YKPSHNIANLHINTIFDQLTKSPAFSKICSPSLIPIQDALTHILTEIKKNSHNLSLSEIA
KKVNS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgccctccgtcttttcttaaaaagcttctctcttctgttcgcaacaatttcatc
atcaaatctatcctaaaagctcctaaagttctttatcacaacggggcttctaaagaagcc
tgcgttctaagctattatggactattcagttgtgttcctatattggtcttcttcctcagg
ctttctcaatacctattcattagtttagactggaaagagtggttactcctccactttccc
gattacaaagcgccgatcttggcaattattgaagcagcttactcaacaactagcaatatc
ggagtggttcttgtcagtagtttctttgtcttctgctgggcaggtattctgatgctacaa
tctttagaagatgggctaaataaaatcttctgttcaggaatcactcaagcttctttaaag
agactaattagctatctagttatcactcttgttagccccatgatctttattattgtttgc
ggatcttggatctatattacacagattctacctatcaactacccccaactatttagtttc
agccattccatggcttttatttatattgtttcacgattacttccctatgctcttctgtac
gggattctcttttgttgctatgcattcctctctagagtccccaccaagaaatctgcagct
ttttttgcagcaactatagctggtagtgcatggatcctttctcaaaaaatcttcttttgc
ctccagctccacctttttaattatagcttcacttacggagctctagttgctttaccctct
tttcttctccttctttacctctatgctattatctatttgtttggaggagccttaaccttc
ttattccaaaacaaaggttttagcattttaatccctaaagaagaaattttcccaagtagc
tatttcaagttcattttatgtgtgtatgttctttccctaatcacagaacactttgataat
gctctccctcctcccagtgcaaactatcttgctaacaaagccaaagcttctattggagaa
acctctcaatgtttagatattttagaaagagagggtatgattcttaaatacaaagagggc
tataagccttctcataacattgcgaaccttcatatcaacaccatcttcgatcagcttact
aagtcccctgctttttctaaaatctgctccccctctcttattcctatacaggatgcgctg
actcatatacttactgaaatcaaaaagaactcgcataacctttccctttcagaaattgct
aaaaaagtgaattcatga

DBGET integrated database retrieval system