KEGG   Chlamydia trachomatis A/363: A363_00709Help
Entry
A363_00709        CDS       T02562                                 

Definition
(GenBank) DNA topoisomerase IV subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
ctrq  Chlamydia trachomatis A/363
Brite
KEGG Orthology (KO) [BR:ctrq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ctrq03032]
    A363_00709
   03400 DNA repair and recombination proteins [BR:ctrq03400]
    A363_00709
Enzymes [BR:ctrq01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     A363_00709
DNA replication proteins [BR:ctrq03032]
 Prokaryotic type
  DNA Topoisomerases
   A363_00709
DNA repair and recombination proteins [BR:ctrq03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      A363_00709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_pol3_delt_C NACHT
Motif
Other DBs
NCBI-ProteinID: CCP48058
LinkDB All DBs
Position
complement(757319..758791)
Genome map
AA seq 490 aa AA seqDB search
MSNLSDLFKTHFTQYASYVILERAIPHVLDGLKPVQRRLLWTLFRMDDGKMHKVANIAGR
TMALHPHGDAPIVEALVVLANKGFLIETQGNFGNPLTGDPHAAARYIEARLSPLAKEVLF
NTDLMTFHDSYDGREQEPDILAAKIPLLLLHGVDGIAVGMTTKIFPHNFCDLLEAQIAIL
NDQPFSLLPDFPPGGTMDASDYQDGLGSIVLRATIDIINDKTLLIKEICPSTTTETLIRS
IENAAKRGIIKIDSIQDFSTDLPHIEIKLPKGIYAKDLLRPLYTHTECQVILTSRPTAIY
QGKPWETTISEILRLQTKTLQNYLKKELLILEDSLSRELYHKTLEYLFIKHKLYDTVRSM
LSKRKTSPSSSAIHNAVLEALTPFLDTLPAPDKQATAQLAALTIKKILCFDENSYEKELA
CLEKKRSSVQKDLSQLKKYTVLYIKKLLETYRQLGHRKTKIAKFDDLPTERISAHKKAKE
LAALDQEENF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacctctcggacctatttaaaactcatttcacacagtatgcgtcttacgtcatt
ttggaacgtgcaatccctcatgttttagatggcctcaagcctgttcaaagaaggcttctt
tggaccttattccgtatggatgatggtaaaatgcataaggtggctaatatcgcaggacgt
acgatggcgctgcacccgcatggtgatgcgcctatcgtggaagctcttgtcgttttggca
aataaagggttcctgatagagacacaagggaactttggtaaccctctcacaggagatcct
catgcagcggctcgttatatagaagcgcggctaagccctttagctaaagaggtacttttt
aatacggatctcatgaccttccatgattcttacgatggaagagagcaagaacccgatatc
ttagctgcaaagattcctctactactccttcatggcgtggatggcatcgcagtagggatg
actacaaaaattttccctcacaacttttgtgatctactagaagcacaaatagctatactg
aatgaccaaccgttttctctccttcccgacttccctccaggaggcacgatggatgcttcc
gactaccaagatggcttaggatccattgttctgcgcgcaacaattgatattattaatgac
aaaaccttgctaatcaaagaaatctgtccttccacaactacagagactctaattcgttct
atcgaaaacgcagcaaaacgaggaatcattaaaatcgattcgattcaagatttctctacg
gacctccctcatatcgagatcaaactccctaaaggtatctacgctaaagatctgttacgc
cctctatatacacatacagaatgtcaggttatcttaacctctcggccaacagctatttac
cagggaaaaccttgggaaacaacgatcagcgaaatcctacgcttacaaaccaagactctc
caaaattacctaaaaaaagaattactcatactagaagattccttaagccgcgagctgtac
cacaaaactttagaatatctattcattaaacataagctttacgataccgtgcgctccatg
ctttctaaaagaaagacgtctccttcatcaagtgccattcacaacgctgttttggaagct
ctgactccatttcttgacacgctcccggctcctgataagcaagcaaccgctcaactagca
gctctaactattaaaaaaatcctctgttttgatgaaaattcctacgagaaggagctggca
tgcttagaaaagaaacgcagtagcgtacagaaagatctgagccaactgaaaaaatacaca
gttctctacattaagaagctgctcgaaacctacagacaactcgggcatcgaaagacaaaa
attgcaaaatttgatgacctacctaccgagagaatctccgctcataagaaagcaaaagaa
ctcgctgcgctcgatcaagaagagaacttctaa

DBGET integrated database retrieval system