KEGG   Chlamydia trachomatis RC-L2(s)/3: CTRC3_00655Help
Entry
CTRC3_00655       CDS       T02772                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ctrw  Chlamydia trachomatis RC-L2(s)/3
Pathway
ctrw00061  Fatty acid biosynthesis
ctrw00620  Pyruvate metabolism
ctrw00640  Propanoate metabolism
ctrw01100  Metabolic pathways
ctrw01110  Biosynthesis of secondary metabolites
ctrw01120  Microbial metabolism in diverse environments
ctrw01130  Biosynthesis of antibiotics
ctrw01200  Carbon metabolism
ctrw01212  Fatty acid metabolism
Module
ctrw_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ctrw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CTRC3_00655
   00640 Propanoate metabolism
    CTRC3_00655
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CTRC3_00655
Enzymes [BR:ctrw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     CTRC3_00655
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CTRC3_00655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 RimK ATPgrasp_ST GARS_A ATPgrasp_Ter ATP-grasp_4 LAL_C2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AGR98187
LinkDB All DBs
Position
139967..141340
Genome map
AA seq 457 aa AA seqDB search
MKKVLIANRGEIAVRIIRACHDLGLATVAVYSMADQEALHVLLADEAVCIGEAQAAKSYL
KIANILAACEITGADAVHPGYGFLSENANFASICESCGLTFIGPSAESIATMGDKVAAKQ
LAKKIKCPVIPGSEGVVKDEVEGIRIAEKIGFPIVIKAVAGGGGRGIRIVREKDEFYRAF
TAARAEAEAGFNNPDVYIEKFIENPRHLEVQVIGDKHGNYVYLGERDCTVQRRRQKLIEE
TPSPILTPEMRAKVGKVAVDLARSAGYFSVGTVEFLLDKEKRFYFMEMNTRIQVEHTITE
EVTGIDLLKAQISVAKGEKLPWKQKNIEFKGHVIQCRINAEDPINNFTPSPGRLDYYLPP
AGPAVRVDGACYSGYAIPPYYDSMIAKVITKGKNREEAIAIMKRALKEFHIGGVHSTIPF
HQFMLDNPKFLLSDYDINYVDQLLASGSTFLNLADGS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagtattgattgcaaatagaggcgagatagctgttcggattattcgagcatgt
catgatctaggattagctactgttgctgtatattctatggcggatcaagaagctttgcat
gtgcttcttgctgacgaagctgtttgtattggagaagctcaggcagcaaaatcctaccta
aagatcgccaatattttagctgcttgtgagattactggggcagatgctgtgcatcctggt
tatggtttcttaagtgaaaatgcaaactttgcttctatttgtgaaagttgtgggctcaca
tttatcggtcctagtgctgagtcgatagcgactatgggagataaagtcgcagctaagcag
ttggctaaaaagattaagtgccctgtaatccctggatctgaaggtgtagtgaaggatgag
gtggaagggattagaattgcagaaaagatcggattccccatcgtcatcaaagctgttgct
ggaggcggtggacgaggaatacggattgttagagaaaaagacgaattctatagggctttt
actgccgctcgggctgaagcagaagcgggatttaataatcctgacgtgtatattgaaaaa
tttattgaaaatccaagacatttagaagttcaagtaattggagataagcacggaaattac
gtgtatcttggagaacgagattgtacagtacaaaggcgtcggcaaaaattaatagaagag
actccaagtcctattttaactccagaaatgcgagctaaagttggaaaagtagcagtggat
ttagctcggagtgccgggtatttctctgttggaacagtagaatttctgttagataaggag
aagcgtttttatttcatggagatgaatacgcgtatccaagtggaacatactattacggaa
gaagtgacagggatcgatttgttaaaggctcagattagtgtcgctaagggagaaaaactg
ccttggaagcaaaagaatatagagtttaaagggcacgtgattcaatgccgaatcaatgca
gaggatccaattaataactttactccttcccctggtagattagattattatctccctcct
gcaggtcctgctgtgcgagtagacggggcttgctacagtggttatgcgatacctccttat
tatgattccatgattgctaaggtaatcacaaaaggaaagaatcgagaggaagcgatagcc
attatgaaaagagctttaaaagagttccatattggtggggtgcattctacaattcctttt
catcagttcatgttggataatccgaagtttcttctttctgattatgatattaattacgtg
gaccagcttttagcgtctggtagcacctttttaaatttagctgatggcagctaa

DBGET integrated database retrieval system