KEGG   Chlamydia trachomatis A/7249: A7249_00106Help
Entry
A7249_00106       CDS       T02564                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
ctrz  Chlamydia trachomatis A/7249
Pathway
ctrz00061  Fatty acid biosynthesis
ctrz00780  Biotin metabolism
ctrz01100  Metabolic pathways
ctrz01130  Biosynthesis of antibiotics
ctrz01212  Fatty acid metabolism
Module
ctrz_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ctrz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A7249_00106
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A7249_00106
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A7249_00106
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ctrz01004]
    A7249_00106
Enzymes [BR:ctrz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     A7249_00106
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     A7249_00106
Lipid biosynthesis proteins [BR:ctrz01004]
 Fatty acid synthase
  Component type
   A7249_00106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: CCP49278
LinkDB All DBs
Structure
PDB: 

Position
complement(119924..120820)
Genome map
AA seq 298 aa AA seqDB search
MLKIDLTGKIAFIAGIGDDNGYGWGIAKMLAEAGATILVGTWVPIYKIFSQSLELGKFNA
SRELSNGELLTFAKIYPMDASFDTPEDIPQEILENKRYKDLSGYTVSEVVEQVKKHFGHI
DILVHSLANSPEIAKPLLDTSRKGYLAALSTSSYSFISLLSHFGPIMNAGASTISLTYLA
SMRAVPGYGGGMNAAKAALESDTKVLAWEAGRRWGVRVNTISAGPLASRAGKAIGFIERM
VDYYQDWAPLPSPMEAEQVGAAAAFLVSPLASAITGETLYVDHGANVMGIGPEMFPKD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaattgatttaacaggaaaaattgctttcatagccggcataggcgatgataac
gggtatggctggggcattgccaaaatgttagcagaagcaggcgcaaccatacttgtgggg
acctgggttcctatctataaaattttctctcaatctttggagttaggaaaattcaatgca
tctcgtgaactctccaatggagaattgctaactttcgctaaaatctatcccatggatgcc
agtttcgacaccccagaagatattcctcaggaaattttggaaaataaacgttacaaagat
ctttctgggtacactgtatccgaagttgtagaacaggtgaaaaaacattttggacacatt
gatattcttgttcactctttagcaaacagtccggaaattgctaaaccattacttgatacc
tctcgtaaaggctatcttgccgccttaagtacatccagctactcctttatcagccttctc
tctcattttggcccaattatgaatgcaggagctagcaccatctctctaacttatcttgct
tccatgcgtgctgttccagggtatggcggaggaatgaacgcagcaaaagctgctttagaa
agtgatacaaaagtactggcttgggaagccggccgacgttggggagtccgagtgaatact
atctcggcagggccattagctagccgtgcaggaaaagctattggatttattgagagaatg
gtggattactaccaagactgggctccactaccttctccaatggaagctgagcaagtaggc
gcagcagcagccttcttagtctctcccctagctagcgcaattacgggagaaactctctat
gtggatcacggagccaatgtgatgggcataggtccagaaatgtttcctaaggattaa

DBGET integrated database retrieval system