KEGG   Chlamydia trachomatis A/7249: A7249_00530
Entry
A7249_00530       CDS       T02564                                 

Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
ctrz  Chlamydia trachomatis A/7249
Pathway
ctrz03030  DNA replication
ctrz03410  Base excision repair
ctrz03420  Nucleotide excision repair
ctrz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctrz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    A7249_00530
   03410 Base excision repair
    A7249_00530
   03420 Nucleotide excision repair
    A7249_00530
   03440 Homologous recombination
    A7249_00530
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ctrz03032]
    A7249_00530
   03400 DNA repair and recombination proteins [BR:ctrz03400]
    A7249_00530
Enzymes [BR:ctrz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     A7249_00530
DNA replication proteins [BR:ctrz03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     A7249_00530
DNA repair and recombination proteins [BR:ctrz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     A7249_00530
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     A7249_00530
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc HHH_5
Other DBs
NCBI-ProteinID: CCP49685
LinkDB
Position
complement(571201..573801)
AA seq 866 aa
MKKLFVLDVSGFVFRAYFALPEMRGPNGESTQAVFGFIRSLDKLIKDLSPEYVVAVFDGP
NNKQSRQELYADYKSNRDRQLGDLPEQIRLVKQYCELLGISCLEEKGVEADDVIASITKK
AVADGFEVCICTADKDLLQLVSSRVSVFNPWKEQEIQYNEVLSQFGVPPEQIADYLALVG
DSSDNIPGVSGCGPKKAQALLKEFQSVEELVANTERLSGKTKQMIEDQKETLLLSKRLAT
LHMDLAFPLTTEEFAFSPQAIDSAQLNTFYLQHGFKALVKHAETATSSIAVQTVTDPVTL
KTVLEQLKGGEVGYCAAYTGEHLPSLQLHGVALAGANQVFYIEVSGVQEIALLKDFFADK
ATQFFGYRSKRDNHALRNSGIDVHVTADLVLAEHLVSGGAKISFQTLLMESGHIQEAVFF
SKEWGAGSLPVQSLPRDPLQYFGMLASKLLAIKNYLFVKLEEKGLKDIFETVEQPLEAVL
FAMECVGMPLDSQGLAVLDRDLTKELEECSQEIYDLVGCEFNIKSPKQLSDILYQRLGIE
PVDKAKSTKAEVLEALEDRHEIIPKILMFRATEKMLSTYVRALPKQINAGTQRIHPTFNQ
VGTVTGRLSCQDPNLQNIPVRSERGRSLREAFRVKKDNDYFLAADYSQIELRFLAHLSQD
EMLKRAFNSGEDIHAFTASQVFNVPLEQVTKQQRYQAKAVNFGLVYGQQAYGLSKILKIS
VSEAQGLMDAYFARYPLAAEFITQTIEQASKNQKVTTMLGRERILSDWESSPGARAASGR
LAVNTRIQGSAAELIKLAMLNISDKMRSRGLKSRLLLQIHDELLFEVPAEELEEMRSLVQ
EKMESAMELSVPLVVNVLIGKNWAEC
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgaaaaaactttttgttttagatgtttcaggatttgtttttcgggcatattttgctctt
cctgagatgcgaggtccaaatggagaaagtacgcaagcggtatttggtttcattcgctct
ttagataagttgatcaaagacctctctcccgaatacgtggttgctgtatttgatggtccc
aataataagcagagccgtcaagagctttatgccgactataaaagtaaccgtgatcgtcag
ttaggggatcttccagagcaaattcgtttagtgaagcaatattgtgaattacttggtatc
tcgtgcttggaagaaaagggtgtagaggctgatgatgtgattgctagtatcactaaaaaa
gcggttgcagatggttttgaagtgtgtatttgcactgccgataaggacttattgcaactg
gtgagcagccgtgtctccgtatttaatccttggaaagaacaggaaatccaatataacgaa
gtactatcgcagttcggagtgcctccggagcagattgcagattacttggcgctagtggga
gattcttccgataatattcctggcgtttctggttgtggtcccaaaaaggctcaagctcta
ttgaaggagtttcaatcagtagaggagttagttgctaatacggaacgtttatctggcaaa
actaaacaaatgatagaagatcagaaagagacgttgcttttgagtaaacgtcttgccacg
ttacacatggatctcgcgttcccgttgacgactgaggagtttgcgttttctccgcaagct
atagattcagcgcagttgaataccttttatttgcagcatggatttaaggctctggtaaag
catgcggaaactgctacgagttccattgcggtacagactgtgacagatccggtaactttg
aagactgttttagaacagttgaaggggggagaagttgggtattgtgcggcttatactggg
gagcatctcccttctttgcagctacacggcgtagccttagctggggccaaccaagtattt
tatatagaggtatctggtgtacaagagattgctttgcttaaagacttttttgcagataaa
gcgactcaattttttggataccgctctaaacgcgataatcacgctttaagaaattctggg
atcgatgttcatgtaacagcagatttggttctagcagagcatttagtgagtggcggagca
aaaatttctttccagactttgttaatggaatccggacatattcaagaagcagtgtttttt
tctaaggaatggggggccggctcgcttcctgtacagagcctaccgcgtgatcccttgcaa
tatttcggaatgcttgcttcaaaattactagcgatcaaaaattatttatttgtgaagtta
gaagaaaaagggctaaaagatatttttgagacggttgagcaacccttggaagccgtgtta
ttcgccatggaatgcgtgggaatgcccttggatagtcaaggattagctgttttggataga
gatctaaccaaagagctcgaagaatgttctcaggaaatttacgatttagttggctgtgaa
tttaatattaaatctcctaagcagttatcagatattttgtatcagcgtttgggaatagag
cctgtggataaagccaaatctacaaaggcagaggttctggaagctctagaagaccgtcac
gagattattcccaagattttgatgttccgtgctacagagaaaatgttgtctacatatgtt
cgagctttgcctaagcagatcaatgcgggaacgcaacgaattcatccaacttttaaccaa
gtaggaacggtaacaggcagattatcctgtcaggatcctaatcttcaaaatattcctgtg
cgttctgaaagagggagatctttgcgagaggcttttcgagttaaaaaagacaatgattat
tttttagccgctgattattcccagattgagttacggtttcttgcccaccttagtcaggat
gagatgttgaagagagcttttaattctggcgaggatattcatgcattcaccgcttcgcaa
gtgttcaatgttcctttggagcaggttacgaagcagcagcgttatcaggctaaagcagtg
aattttggcttagtgtatggacagcaggcgtatggattatcaaaaattttaaagattagc
gtaagtgaggctcagggattaatggatgcctattttgcgcgttatcctctagcagcagaa
tttattacacagacgatagagcaagctagtaagaatcagaaagtaaccacaatgctaggg
agagagcgtattctgagcgattgggagagctctcctggagctcgtgccgcttctgggaga
cttgctgtaaatacgcgtatacaagggagtgctgcagagttaattaagttggctatgttg
aatatctcagacaaaatgaggtcgaggggattaaaaagtcgtttattattacaaattcat
gacgaattattatttgaagtccctgcagaagaattggaagagatgagaagtctagttcaa
gagaaaatggagtctgcaatggagctgtctgttcctttagttgtgaatgtcttaattgga
aaaaattgggcggaatgctag

DBGET integrated database retrieval system