KEGG   Chloroherpeton thalassium: Ctha_0820Help
Entry
Ctha_0820         CDS       T00726                                 

Definition
(GenBank) ABC transporter-related protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
cts  Chloroherpeton thalassium
Brite
KEGG Orthology (KO) [BR:cts00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cts02000]
    Ctha_0820
Transporters [BR:cts02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Ctha_0820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 AAA_23 MukB AAA AAA_29 Rad17 AAA_30 SbcCD_C RsgA_GTPase AAA_19 AAA_16
Motif
Other DBs
NCBI-ProteinID: ACF13288
UniProt: B3QWS4
LinkDB All DBs
Position
complement(978955..979872)
Genome map
AA seq 305 aa AA seqDB search
MLQLNQVSKFYNNHTAVEKLSFEVQSGQIFGLLGPNGAGKTTTIRMICGILHPDEGEIFF
LNQHISSELQARIGYLPEERGLYKKMKVAEILLYFARLKGQEASVAKEKISYWLKRFDIQ
DWREKKIEELSKGMQQKVQFISVVLHEPDLLILDEPFSGLDPINSELILDAILELKAAGK
TLLFSTHRMEQVEKICDNIVLIHNGKKVLGGKVLEVKAAYGKNTLQVDFEGNDSFIDELV
LSGSVAVSERHPKSVELRLLGSTTLKTLLPFINERTELRRAELALPSLKDIFIMQVEGAR
HKPIS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaactcaatcaagtctcaaagttttataacaatcatactgccgtagaaaagctg
tcgtttgaggttcaatcggggcaaatctttgggttgctgggtccaaatggcgccggaaaa
accaccaccattcgcatgatttgcggaattttgcatcctgatgaaggagagattttcttt
ttaaatcaacacatttcttccgaactgcaagctcgcattggctatttgcccgaagagcgc
gggctatataagaaaatgaaggtcgccgaaattttgctttacttcgcgcggctcaaaggg
caagaggcttccgtagcgaaagagaaaatctcatattggctcaagcgatttgatatccag
gattggcgcgagaagaaaattgaggagctctcgaaaggaatgcagcaaaaagtccaattc
atttctgtggtgctccacgagcctgatttgctgattttggacgaaccattcagcggactc
gacccgattaattcagagctcattttagatgccattcttgaactgaaagccgcaggcaaa
acattgttgttttccacccatcgtatggaacaggttgaaaaaatttgcgacaacattgtg
ctcattcacaatggcaaaaaagtattaggtggaaaagtcttggaagtgaaagcggcctat
ggaaaaaatacgctccaagtggattttgaaggcaacgacagctttatcgatgaactggtt
ttgtctggttcggtcgctgtttcggagcgccatccgaaatcggtggaactgcgtttgctg
ggttccacaacattgaaaactcttttgcctttcatcaatgaacgaaccgagcttcgccgc
gccgaacttgccttgccatcgctcaaagatattttcatcatgcaggttgagggcgcgaga
cataagcccattagctga

DBGET integrated database retrieval system