KEGG   Chloroherpeton thalassium: Ctha_2377Help
Entry
Ctha_2377         CDS       T00726                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cts  Chloroherpeton thalassium
Brite
Enzymes [BR:cts01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ctha_2377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF1007
Motif
Other DBs
NCBI-ProteinID: ACF14827
UniProt: B3QX17
LinkDB All DBs
Position
2859943..2860545
Genome map
AA seq 200 aa AA seqDB search
MAYEQPKLPYELNALEPHISANTLEFHYGKHHAAYVTKYNGFVKDTPYDKMPLEDVIKAT
AGDASKAGIFNNGAQAWNHSFYWNCLSPNGGGAPTGKIADKINEDCGSYENFVAAFKDAA
ATQFGSGWAWLVLDGGKLKITKTLNAANPMTEGQTTLLTLDVWEHAYYLDYQNRRPDYIQ
TFLEKLVNWDFVNQNLEAAM
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaacaaccgaaactcccgtatgagctaaacgctcttgaaccacacatctct
gctaacacgcttgaatttcattatggcaaacaccatgcggcttatgtgaccaagtacaac
ggctttgtaaaagacacgccgtacgacaagatgccgcttgaagatgtgattaaagcaacg
gctggcgatgcctcaaaagccggaatctttaacaacggcgcccaagcatggaatcacagt
ttttactggaattgcctatcacctaacggcggcggcgcaccaacgggaaaaattgccgac
aaaattaacgaggattgcggtagctatgaaaattttgtagccgcatttaaagatgctgcc
gccacacagtttggaagcggctgggcttggcttgttttggatggtggaaaattaaaaatc
accaaaacgctcaacgccgcaaaccccatgactgaaggacaaaccacacttttaactctt
gatgtttgggaacacgcttattatttggattatcaaaatcgacgtcctgactatattcaa
actttccttgagaaactcgttaattgggattttgtcaatcaaaatcttgaagctgcgatg
taa

DBGET integrated database retrieval system