KEGG   Chloroherpeton thalassium: Ctha_2426Help
Entry
Ctha_2426         CDS       T00726                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cts  Chloroherpeton thalassium
Pathway
cts00500  Starch and sucrose metabolism
cts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ctha_2426
Enzymes [BR:cts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Ctha_2426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: ACF14875
UniProt: B3QX65
LinkDB All DBs
Position
2911836..2913284
Genome map
AA seq 482 aa AA seqDB search
MGVMMQAFYWDCPRVEGQEFLWWEYVKEKIPALAQAGFSALWLPPAHKAPNINGLSMGYD
PYDYYDLGEYDQKGYVKTWFGSKRELLDLIDLAHSYQLSVIADIVINHNNGADAEEVNPI
DGHTRWTLFSQPKSGKFLRSWDCFHPTHYETWDDGTFGDMPDLCHRNPYVYTEILKLAKW
LIEDIGFDGFRYDFVKGYGTWIIKAIQEQRYTKNGQPFKPYGVAENWSSDREIEDWLNEV
NNWNDNPVDAFDFPLRYQLKNLCDVYGFSLKNLIGSHTVFYDKPFGAVTFVDNHDFRGDD
TPQITHDKLLAYSVILTHEGYPCVFWQDYYSWDLAKEGSPNGIAALIEAHEQFAAGSTST
LWLDDNLYIMQRTGFENKPGLIFVLNNRQAIVGTGRGFPHSGKILISSRLPGGAAASLTR
LIINMSTTMAVANFGRRLADMWFISRKSNQRLFEKLLVELRLERQRAALIPGAAFCGHAT
CH
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcatgatgcaagctttttactgggactgtccgagagtagaaggacaagaattt
ctatggtgggaatatgttaaggaaaaaattcctgccttagctcaagctggctttagcgct
ttgtggctaccgccagcacataaagcgccaaacattaatggattatctatgggctacgac
ccttacgattattacgatctcggcgaatacgaccaaaagggttatgtaaaaacctggttt
ggctcaaaacgcgagttacttgatttaattgatttggctcattcttatcagttaagcgtg
attgcagatatcgtgatcaaccacaacaacggcgccgacgcagaagaagtcaatccaatt
gatggccacacgcgctggacacttttcagtcaacccaaaagtggaaaatttcttcgcagt
tgggactgctttcacccaactcactatgagacttgggacgatggcacatttggcgacatg
cccgatctttgccatagaaacccatatgtttataccgagattctcaagttagccaaatgg
ctgatcgaagacattggcttcgacggtttccgatacgactttgtaaaaggctatggaacc
tggatcatcaaggcaattcaagagcaacggtatacaaaaaacggccaaccgttcaagcct
tacggcgttgccgagaattggtcgagcgatcgggaaattgaagattggctcaacgaagtc
aacaattggaatgataatcctgttgacgcctttgattttcctttaagatatcaactcaaa
aacctatgcgatgtttatgggtttagcttaaaaaatttgatcggcagccacacggttttt
tatgacaaaccattcggagcggttacgtttgttgataatcatgatttccgaggagacgac
acgccacaaatcactcatgataaattattggcttatagtgtcattttaacgcatgagggc
tatccgtgtgtattttggcaagattattacagttgggatttagccaaagaaggctcgcct
aacggcatcgcggccttgatagaagctcatgaacagtttgcagccggttccacaagcacg
ctctggctcgatgacaacttatacattatgcaacgaacaggtttcgaaaataaacccggt
ttgatttttgtcctgaacaacagacaggcgatagttggaacggggcgtgggtttccacac
agtggaaaaatattgatttcgagccgattgcctggtggagcagcagcgagcttgacacgc
cttatcatcaacatgtctacgacgatggccgtggcgaattttgggcgccgcctcgcggat
atgtggtttataagccgaaagtctaaccaacgactttttgaaaaattgttagtcgaactg
cgacttgagcggcaacgagcggcgcttattcctggcgccgctttttgcggccatgcaacc
tgccactga

DBGET integrated database retrieval system