KEGG   Comamonas thiooxydans: CtCNB1_0035Help
Entry
CtCNB1_0035       CDS       T01109                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CtCNB1_0035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctt02000]
    CtCNB1_0035
Enzymes [BR:ctt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CtCNB1_0035
Transporters [BR:ctt02000]
 Other Transporters
  Pores ion channels [TC:1]
   CtCNB1_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_C_2 GST_C_3 GST_N_2 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: ACY30781
UniProt: D0J7P1
LinkDB All DBs
Position
complement(44119..44727)
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSMSPHIVLHEAGLPHETVMVSTKSHKLQDGTDYYGINPLGYVPFLVLDNG
DTLHEGPAIVQYLADLAPEKNLAPANGTVARYHLQEWLNFISTEVHKGFSPLFSPATPED
FKPVLLGNLFKRLSWVNEQLANKSYLMGDQFTVADAYFFTVTGWAQFVGLDISELQHLQA
YRERILARPAVQAAMKAEGLLK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttactacagccccggcgcttgctccatgtctccgcacatcgtgctgcatgaa
gcaggcctgccgcatgaaaccgtgatggtcagcaccaagagccacaagctccaggacgga
acggattactacggcatcaatccgctgggttatgtgccctttctggtgctggacaacggc
gacaccttgcacgaaggtccggccattgttcagtacctcgccgacctggcccccgaaaag
aacctggcgccggccaacggcaccgtggcacgctaccaccttcaggaatggctgaatttc
atcagcaccgaggtgcacaagggcttcagccccttgttcagccccgcaacgcccgaagac
ttcaagcctgtgctgctcggcaatctgttcaagcgcctgagctgggtcaacgagcagctc
gccaacaagtcctatctgatgggcgatcagttcaccgtggctgatgcctactttttcacg
gtcacaggctgggcccaatttgtaggcctggacatctctgaactccagcaccttcaggct
tatcgcgagcgcattctggcgcgccccgcagtgcaggctgccatgaaggcagagggcttg
ctcaagtaa

DBGET integrated database retrieval system