KEGG   Comamonas thiooxydans: CtCNB1_0300Help
Entry
CtCNB1_0300       CDS       T01109                                 

Definition
(GenBank) peptidase S11, D-alanyl-D-alanine
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00550  Peptidoglycan biosynthesis
ctt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CtCNB1_0300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ctt01002]
    CtCNB1_0300
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctt01011]
    CtCNB1_0300
Enzymes [BR:ctt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CtCNB1_0300
Peptidases and inhibitors [BR:ctt01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CtCNB1_0300
Peptidoglycan biosynthesis and degradation proteins [BR:ctt01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CtCNB1_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP5_C Peptidase_S11 Rib
Motif
Other DBs
NCBI-ProteinID: ACY31046
UniProt: D0IWM8
LinkDB All DBs
Position
335599..336216
Genome map
AA seq 205 aa AA seqDB search
MHDFPEYMHYYATKQYSYPGTPASNGSNRNALLFRDPTVDGLKTGHTNAAGYCLVATAKR
DLPNVGQRRLLSIVLGTASEKARANESQKLLNWGYTAFDAVKLFDSDQPVATPAVWKGAA
NAVKIGKADGAVVVTVPSGTGGKLTTEVVRQDPLIAPIAKGQSMGVLKVKSGADVVAEVP
LVALEAVEQAGFFGRLWDTIRLWIK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacttccccgagtacatgcactactacgccaccaagcaatacagctacccaggc
acgcccgcctccaacggcagcaaccgcaatgccttgctgttccgcgatcccaccgtggac
ggcctgaagaccggtcacaccaatgccgccggctattgcctggtggccacggccaagcgt
gacctgcccaatgtgggtcagcgccgcctgctgtccatcgtgctgggaacggccagcgaa
aaggcgcgtgccaacgaaagccagaagctgttgaactggggttacaccgctttcgacgcc
gtcaagctgtttgattccgatcagcccgtggccactcccgccgtctggaagggcgcggcc
aatgccgtcaagatcggcaaggccgacggcgccgtggtggtgaccgtgccctcgggtacc
ggcggcaagctgaccaccgaggtggtgcgccaggatccgctgattgcacccattgccaag
gggcagtccatgggggtgctcaaggtcaagtcgggtgcggatgtggtggccgaggtgccg
ctggtagcgcttgaggccgtcgagcaggcaggcttctttggccgtctgtgggacaccatc
cgcctctggatcaagtaa

DBGET integrated database retrieval system