KEGG   Comamonas thiooxydans: CtCNB1_0667Help
Entry
CtCNB1_0667       CDS       T01109                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00550  Peptidoglycan biosynthesis
ctt01100  Metabolic pathways
ctt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CtCNB1_0667
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CtCNB1_0667
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ctt01003]
    CtCNB1_0667
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctt01011]
    CtCNB1_0667
Enzymes [BR:ctt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CtCNB1_0667
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CtCNB1_0667
Glycosyltransferases [BR:ctt01003]
 Polysaccharide
  Bacterial polysaccharide
   CtCNB1_0667
Peptidoglycan biosynthesis and degradation proteins [BR:ctt01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CtCNB1_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB DUF1627
Motif
Other DBs
NCBI-ProteinID: ACY31413
UniProt: D0IZG3
LinkDB All DBs
Position
complement(750885..753215)
Genome map
AA seq 776 aa AA seqDB search
MHWLPRSIFWLIGLAVAAALAVLLAVAVALAMAYPNLPDVSELADYRPKLPLRVYSSEGA
LLGEFGEERRTLTPINEIPKVMTDAVLAIEDTRFFEHGGVDYKGMLRAALANLGKVKSQG
ASTITMQVARNVYLSSEKTYTRKIYEILLTFKLEHLLTKEQILEIYMNQIFLGNRAYGFA
AACEAYFGHPLKDITVAEAAMLAGLPKAPSAYNPISNPKRARIRQLYIIERMEENGFITA
DQAKQAREEPLKLRTAANSTRVHAEYVAEMARQLIFAQYGSDAYTRGLNVYTTLNAGEQE
AAYKALREGIMNYERRQKYRGPEKFITLPANAQELEDAIDDALANHPDNGDVVAAVVLEA
SPRKIVAARADGTHFEITGDNLKPAESGLSPKAPPNIKIRPGAVIRAIKNAKGAWEITQL
PEVEGAFVAMSTQTGAIRALIGGFDFEKNKFNHVTQAWRQPGSSFKPFIYSAALEHGFSP
STMINDAPIFFSAATTGGQPWEPKNYDGRYDGPMTMRTGLNKSKNMISIRLLQAIGPKTG
QEWATRFGFEAAKQPAYLTMALGAGSVTPLQMAGAYSVFANGGHRINPWLIARVTDHKGR
ILSEFTPPAVKELPQAIPERNAFLTGTLLNDVARVGTAARAQATLKRPDLYGKTGTTNDS
VDAWFAGYQPSIAAVSWIGYDTPRNLGSRETGGGLSLPIWINFMQHALKGVPVAEVQTPP
GVVNMGGDWYYEENARNGGVSSLGMEGASDPGNAGPGATQPPAAEERSRILDLFRN
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgcactggctgccgcgttccattttctggctgatcggacttgccgtcgccgccgccttg
gccgtgttgctggccgtggccgtggcgctggccatggcttaccccaatcttccagacgtc
tccgaacttgcagactaccgccccaagctaccgctgcgggtctactccagcgaaggcgct
ctgctgggcgaatttggggaggagcgtcgcaccctgacgcccatcaacgagatccccaag
gtcatgacggatgccgtgctggccatcgaagacacccgcttcttcgagcatggcggcgtg
gactacaagggcatgctgcgtgctgcgctggccaacctgggcaaggtcaagagccagggc
gcctccaccatcaccatgcaggtcgcacgcaatgtctacctctcttccgagaagacctat
acccgcaagatctacgaaatcctgctgaccttcaagcttgagcacttgctcaccaaggag
cagatcctcgagatctacatgaaccagattttccttggcaaccgtgcctatggctttgca
gcagcctgtgaagcctatttcggccatccgctcaaggacatcacggtggccgaagccgcc
atgctggcaggcctgcccaaggctccatcggcctacaacccgatcagcaaccccaagcgc
gcccgcatccgccagctctacatcatcgagcgcatggaggaaaacggtttcatcaccgca
gatcaggccaagcaggcccgcgaagagccgctcaagctgcgtactgccgccaattcgacc
cgtgtacatgcagagtacgtggctgaaatggcccgtcaactgatctttgcccaatacggc
agcgacgcctatacccgcggcctgaacgtctacaccactctcaatgccggtgaacaagag
gctgcctacaaggctttgcgcgaaggcatcatgaactacgaacgccgccagaagtaccgc
ggccccgagaagttcatcactctgccagccaacgctcaggagctggaagacgccatcgac
gatgccctggccaaccatcccgacaacggcgatgtggttgcggccgtggtgctggaagcc
tcgccgcgcaagattgtcgcggcccgtgcggacggtacccatttcgagatcacgggcgac
aacctcaagcccgccgaatccggcctcagccccaaggcaccgcccaatatcaagatccgc
cccggtgccgtgatccgcgccatcaagaacgccaagggtgcctgggaaatcacccagttg
cccgaagtcgaaggcgcttttgtggccatgtccacgcaaaccggcgcaatccgcgcgctg
atcggtggtttcgacttcgaaaagaacaagttcaaccacgtgacccaggcctggcgccag
ccgggctccagcttcaagcccttcatctactcggcagcgctggagcacggtttctcgccc
tccaccatgatcaatgacgcaccgatcttcttcagtgcggcaaccaccggtggtcagccc
tgggagcccaagaactacgacggccgctacgacggcccgatgaccatgcgcacgggcttg
aacaagtccaagaacatgatctccatccggttgctgcaggccatcggccccaagaccgga
caggaatgggcgactcgcttcggctttgaagccgccaaacagcccgcttacctgaccatg
gctttgggcgccggttccgtcacgccgctgcagatggcgggagcctattcggtgtttgcc
aacggcggccaccgcatcaacccctggctgattgcccgagtgacagaccacaagggtcgc
atcctctccgagttcacgccgccagcggtgaaggaactgccccaggccatccccgagcgc
aatgccttcctcaccggcaccctgctcaatgatgtggcacgcgtgggcacggctgcacgt
gcccaggccacactcaagcgccccgacctgtatggcaagaccggcaccaccaatgactcg
gtggacgcctggtttgccggctaccagcccagtattgccgcagtctcctggattggctac
gacaccccgcgcaacctgggttcgcgcgaaaccggtggcggcctgagcctgcccatctgg
atcaatttcatgcagcacgcactcaagggtgtgccggtggccgaagtgcagaccccgccc
ggagtggtcaatatgggcggcgactggtattacgaagaaaacgcccgcaacggcggcgtc
tccagcctcggtatggaaggcgcctccgatcctggcaacgcaggcccgggtgccacccag
ccgcctgccgcagaggagcgcagccgcattctggacctgttcagaaactaa

DBGET integrated database retrieval system