KEGG   Comamonas thiooxydans: CtCNB1_1177Help
Entry
CtCNB1_1177       CDS       T01109                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ctt  Comamonas thiooxydans
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CtCNB1_1177
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CtCNB1_1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 Glutaredoxin NAD_binding_7 Thi4 K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: ACY31923
UniProt: D0J2F7
LinkDB All DBs
Position
1316043..1317599
Genome map
AA seq 518 aa AA seqDB search
MLDDQLKAQLAAYLERVQQPFELVASLDDSETSAQMHDLLKTIQSLRSDKISLRTDGSDA
RKPSFTLQRQGTATQLRFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVIDQIKALDGDFN
FEVYMSLSCHNCPDVVQALSLMAILNPKVKTTVIEGGAFQKEVTEREIMAVPMVFMNGSV
FGSGRMTIEEIVAKLDTGAASRDAAKLSAKEAFDVLIIGGGPAGAAAAVYAARKGIRTGV
AAERFGGQVNDTLAIENYISVLETDGPKFAAALEAHTRAYDVDIMNLQRAEKLIPAAQPG
GLVEVQMANGGSLKAKTVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVSV
IGGGNSGIEAAIDLAGLVAHVTVVEFADQLKADAVLVKKLHSLPNVTVITNAQTTEITGA
NGKVNGLSYKDRTSGAEHHVELEGVFVQIGLVPNTEWLKGTLELSKFGEIMVDAKGQTSL
PGVFAAGDCTTVPYKQIVIAAGAGATAALSAFDHLIRN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgatcaactcaaagcccaactcgccgcctacctggaacgcgtgcagcagccg
tttgagctggtggcttctctggatgacagcgagaccagtgcacagatgcacgatctgctg
aagaccatccagtccctgcgcagcgacaagatttcgctgcgcaccgacggcagcgatgcc
cgcaagccctcgttcacgctgcagcgccagggcacggccacccagctgcgttttgccggc
ctgcccctgggccatgagttcacctcgctggtgctggccctgctgtggacgggcggccat
cctcccaaggtggagcaggatgtgatcgaccagatcaaggctctggacggcgacttcaac
ttcgaggtctatatgagcctgagctgccacaactgccccgacgtggttcaggcgctgtcg
ctgatggccattctcaaccccaaggtcaagaccacggtgatcgaaggcggtgccttccag
aaggaagtgaccgagcgcgaaatcatggccgtgcccatggtgttcatgaacggcagcgtg
ttcggctccggtcgcatgaccatcgaagaaatcgtggccaagctggacaccggtgcagcc
tcgcgtgacgcagccaagctgtcggccaaggaagccttcgacgtgctgatcatcggtggc
ggtcctgccggcgcggcagccgccgtgtacgcggctcgcaagggcattcgcaccggcgtg
gcagccgagcgttttggcggccaggtcaacgacacactggcgatcgagaactacatctcc
gtgctggaaaccgacggacccaagttcgccgcagctctggaagcccacacccgtgcctat
gacgtggacatcatgaacctgcagcgtgccgagaagctgattcccgcagcgcagcccggc
ggcctggtggaagtgcaaatggccaatggcggctcgctcaaggccaagaccgtgatcctg
tccacgggtgcgcgctggcgcaatgtgaacgtgcctggtgaggccgagtacaagaacaag
ggcgtggcttactgcccgcactgcgatggtccgctgttcaagggcaagcgcgtgtcggtg
atcggcggcggcaactccggcatcgaagctgcgattgacctggcgggtctggtggcccat
gtgacggtggtggaatttgccgatcagctcaaggccgatgccgtgctggtcaagaagctg
cacagcctgcccaatgtgaccgtcatcaccaatgcccagaccaccgagatcacgggggcc
aacggcaaggtcaacggcctgagctacaaggaccgtacaagcggcgcagagcaccatgtg
gagctcgaaggtgtgtttgtgcagatcggcctggtgccgaacaccgaatggctcaagggc
acactggagctgagcaagttcggcgaaatcatggtggatgccaaggggcagaccagtctg
cccggggtgttcgccgccggtgactgcaccacggtgccttacaagcagatcgtgatcgcc
gccggcgccggtgccactgcagcgctatcggccttcgatcatctgatccgcaactaa

DBGET integrated database retrieval system