KEGG   Comamonas thiooxydans: CtCNB1_1297Help
Entry
CtCNB1_1297       CDS       T01109                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase, NAD-binding protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00071  Fatty acid degradation
ctt00280  Valine, leucine and isoleucine degradation
ctt00281  Geraniol degradation
ctt00310  Lysine degradation
ctt00362  Benzoate degradation
ctt00380  Tryptophan metabolism
ctt00410  beta-Alanine metabolism
ctt00640  Propanoate metabolism
ctt00650  Butanoate metabolism
ctt00903  Limonene and pinene degradation
ctt00930  Caprolactam degradation
ctt01100  Metabolic pathways
ctt01110  Biosynthesis of secondary metabolites
ctt01120  Microbial metabolism in diverse environments
ctt01130  Biosynthesis of antibiotics
ctt01200  Carbon metabolism
ctt01212  Fatty acid metabolism
Module
ctt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CtCNB1_1297
   00650 Butanoate metabolism
    CtCNB1_1297
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CtCNB1_1297
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CtCNB1_1297
   00310 Lysine degradation
    CtCNB1_1297
   00380 Tryptophan metabolism
    CtCNB1_1297
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CtCNB1_1297
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CtCNB1_1297
   00281 Geraniol degradation
    CtCNB1_1297
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CtCNB1_1297
   00930 Caprolactam degradation
    CtCNB1_1297
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CtCNB1_1297
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CtCNB1_1297
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CtCNB1_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DAO UDPG_MGDP_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C Shikimate_DH DFP NAD_binding_8 FAD_binding_3 NAD_Gly3P_dh_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACY32043
UniProt: D0J363
LinkDB All DBs
Position
1465077..1467236
Genome map
AA seq 719 aa AA seqDB search
MTTEIILYAVDEDGIATLTLDYPGKTMNVIDQAFMDSLEACIARMHGDDRVRGGIITSGK
DSFVAGADLMGMEANIDAMADMPIEELFDSCASLSRLLRKLETLGKPLVAAINGMALGGG
YEICLACHHRIAADAPTVMVGLPEAQVGLLPGAGGTQRLPRMIGILAAMPFLMEGKQLQA
VKAREAGLVDEVVAPEQLLSAAKAWLLARPTALQPWDVKGFRIPGGGPLDARVAPAFVVG
NTMLQAKTFHNMPAPLCIQSCIYEGCQLPIDKGLRIESKYMATLSRSPVARGMIRTLFVN
KAKAEKGMHRPAGLEPFQCRKLGLIGAGMMGAGIALVAAQRGIQVVLIDRDQAAADKGKQ
YSEKTLARQVDKGRQSREKADAILARITPGTDYELLRDADMVVEAVFEDRAIKAEVTRKL
DAVLPPGCVLASNTSALPISLLAQASDRPDRFIGLHFFSPADKMPLVEVIRGKQTSDATL
AQALDFVAQLKKTPIVVNDKRGFFTSRFIGAFVDDAIGMVAEGIAPALIENCAKHAGMPV
GPLAITDELSIDLSKHAGESQAKEFPEEYKPGRSVPVIGKLFELGRLGRKVGKGFYDYDE
SGKRIWPGLAEHYPLKATQPSAHDLKQRILYVQAVEGARAMEEGVLLAPADGDIGSILGV
GFPVYTGGPFCFIDGIGLAQFVAEADRLADLFGEQLRPPQLLRDMAAKGQTFYGKSARA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgacaacggaaatcattctctacgccgtagatgaggacggcattgccacgctgacgctg
gattaccccggcaagaccatgaatgtgatcgaccaggccttcatggacagcctggaagcc
tgtatcgcacgcatgcacggcgacgaccgggtgcgcggcggcatcattacctcgggcaag
gacagctttgtcgcgggggccgacctgatgggcatggaggccaatatcgacgccatggcg
gacatgcccatcgaggaactgttcgactcctgcgcatcgctgtccaggctgctgcgcaaa
ctggagaccctgggcaagccgctggtggcggccatcaacggcatggcattgggcggcggc
tatgaaatctgcctggcctgccaccaccgcattgcagccgatgcccccacggtcatggtc
ggcctgcccgaggctcaagtgggcttgctgcccggcgccggcggcacccagcgtctgccg
cgcatgatcggcattctggccgccatgccttttctcatggagggcaagcagttgcaggca
gtgaaggccagggaagccggtctggtggacgaagtggtggctcccgagcagttgctcagt
gctgccaaggcctggctgctggccaggcccacggcgctgcagccctgggatgtgaaaggc
tttcgcatccccggtggcggcccgctggatgcgcgcgtggctccggccttcgtggtgggc
aacaccatgctgcaggccaagacctttcacaatatgccagcgccgctgtgcattcaaagc
tgcatctacgaaggttgccagctgcccatcgacaagggcctgcgcatcgagagcaagtac
atggccacgctgtcgcgcagtcccgtggcgcgcggcatgattcgcaccctcttcgtcaac
aaggccaaggccgagaaaggtatgcaccgtcctgcaggcttggagcccttccaatgccgc
aagctgggtctgataggcgcaggcatgatgggcgcgggcattgccttggtggccgcccag
cgcggtattcaggtggtgctgatagaccgggatcaggcggcagcggacaagggcaagcag
tactccgagaagacgctggccaggcaggtggacaaggggcgccagagccgcgagaaggcc
gatgccatcctcgcccgcatcacgcccggcaccgattacgagctgctgcgcgatgccgat
atggtggtcgaagccgtgtttgaagaccgagccatcaaggctgaagtgacccgcaagctg
gacgccgtgctgccgcctggctgcgtgctggccagcaacacctcggcactgcccatcagc
ctgctggcgcaggcgagcgacaggcccgatcgcttcatcggtctgcatttcttctcgccg
gccgacaagatgccgctggtggaagtcattcgcggcaagcagacatcggatgccacgctg
gcgcaggcactggatttcgtggctcagctcaagaagacgcccattgtcgtcaacgacaag
cgcggctttttcaccagccgcttcatcggcgcgtttgtggatgacgccatcggcatggtg
gcagaaggcattgcccctgcattgatagagaactgtgcaaagcatgcgggcatgcccgtg
gggccgctggcgattaccgacgagctgtcgattgatctgtccaagcatgcgggcgaatcc
caggccaaggagttcccagaggaatacaagcctggtcgctccgtgccggtgatcggcaag
ctgttcgagctgggccgcctgggccgcaaggtgggcaagggcttctatgactacgatgaa
agcggcaagcgcatctggccgggcctggccgagcattacccgctgaaagccacgcagccc
agtgcgcatgacctcaagcagcgcattctctatgtgcaggccgtcgaaggagcgcgcgcc
atggaggagggtgtgctgctggcgccggccgatggcgacatcggctcgattctgggggtg
ggctttcccgtctataccggcggccccttctgctttatcgacggcataggtctggcgcag
ttcgtggccgaggccgatcgcctggcagatctgtttggcgagcaactgcgcccgccacag
ctgctgcgggatatggcggccaagggccagaccttctacggcaagagcgcaagagcctga

DBGET integrated database retrieval system