KEGG   Comamonas thiooxydans: CtCNB1_3454Help
Entry
CtCNB1_3454       CDS       T01109                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ctt  Comamonas thiooxydans
Pathway
ctt00260  Glycine, serine and threonine metabolism
ctt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CtCNB1_3454
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     CtCNB1_3454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C PALP ADH_zinc_N_2 Sacchrp_dh_NADP F420_oxidored Shikimate_DH 2-Hacid_dh_C ADH_N_2 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ACY34200
UniProt: D0J3K6
LinkDB All DBs
Position
complement(3905447..3906565)
Genome map
AA seq 372 aa AA seqDB search
MKGGNTADPVRSEMHVHACIASLMQALQKTESAKGLKLNEVDMPSPAAGEVLLRVHSTGV
CGTDLHIDAWTASYHFLQAALPVTVGHEFSGEIVARGEGAEHLPLGQLVAVRPSVTCGRC
PSCSAGDFDACTTRRGIGVMRHGGFAEYVAVPLRNCVPIPHGVDPEVAALAEPLSVSFEA
VRTGNVQPGDRVLILGPGNIGQGIALFARAAGAAQVVVAGHGDAARLEVLRSMGFEDLLD
FEGQDIDEALAAYTQQALFDVVIEATGAAAVLAPALRALKTHGVLVIAGIHSAPVPLDLT
ALVRRHQQLRGSYRAPERCWLEVVEFMQTHQDQLRLMITHRVPLAQAPQGFELARARLAS
KVLIQPGADSAS
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcggcaacactgccgatcctgttcgttctgagatgcatgtccacgcatgcatt
gcctctctcatgcaagccttgcaaaaaaccgagtccgccaagggactgaagctcaacgag
gtcgacatgccgtcgcctgccgcaggtgaagtgctgctgcgggttcattccaccggtgtc
tgtggcacggatctgcatatcgatgcctggacggcgagctatcactttttgcaggccgcg
ctgccggtgaccgtgggtcacgagttcagcggcgagatcgtggccagaggcgagggggcc
gagcatctgcccctgggccagttggtggccgtgcggccttcggtcacctgcggcagatgc
cccagttgcagtgccggcgacttcgatgcctgcaccacccgccgcggcatcggtgtcatg
cgccatggcggctttgccgagtatgtggccgtgcccctgcgcaattgcgtgccgattcca
cacggcgtggaccccgaggttgctgcactggccgagccgctgtcggtgagcttcgaagcc
gtgcgcacgggcaatgtccagcccggcgatcgcgtgctgatcctggggcccggcaatatc
ggccagggcattgcgctgtttgcgcgtgccgcaggggcagcccaggtggtggttgccggc
catggcgatgccgcgcggctggaggtcctgcgctccatggggttcgaggatttgctggac
ttcgaggggcaggacatcgacgaagcccttgccgcctatacgcagcaagctctctttgat
gtggtgatcgaagccaccggggcagctgccgtgctggcgccggccctgcgtgcactcaag
acccacggtgtgctggtgattgccggcattcattccgctcctgtgccgctggatctgacg
gccctggtgcgacgtcaccagcagctgcgcggctcctatcgggcgcccgagcgctgctgg
ctggaggtcgttgaattcatgcagacccatcaggatcagctgcgcctcatgatcacccat
cgcgtgccgcttgcgcaggccccgcagggttttgagctggcgcgcgcgcggctggcgagc
aaggtgctgattcagcccggcgcggattctgcatcatga

DBGET integrated database retrieval system