KEGG   Comamonas testosteroni CNB-2: CtCNB1_4444Help
Entry
CtCNB1_4444       CDS       T01109                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ctt  Comamonas testosteroni CNB-2
Pathway
ctt00564  Glycerophospholipid metabolism
ctt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CtCNB1_4444
Enzymes [BR:ctt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CtCNB1_4444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Thi4 Pyr_redox_2 HI0933_like NAD_binding_8 FAD_binding_3 GIDA Lycopene_cycl 3HCDH_N Pyr_redox_3 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ACY35190
UniProt: D0IV33
LinkDB All DBs
Position
complement(4983524..4985119)
Genome map
AA seq 531 aa AA seqDB search
MNQSTQPLATTRAQLLERLAQTESFDLAIVGGGATGLGVAVDAAARGFKVVLLESLDFAK
GTSSRATKLVHGGVRYLAQGNISLVREALHERTTLLHNAPHLAQPLAFVMPSYKLLDTPF
YGIGLKMYDALAGKAGLGATEFLSSAKTVKYLPTVQQKGLKGGVKYWDGQFDDARLALAL
ARTAAAKGALLINYCPAEKLIYEGQQIAGLICRDAESGRNFTVRAKCVVNATGPWVDLFR
QQDAEAQGKPVKPMVAPSQGVHVVVDREFLPTDHALLIPKTADGRVLFAVPWLGKVILGT
TDTPRHDLAREPLPFPEELDFILGEAGKYLNRQPTLADVRSMWVGLRPLVKPQDDDGENT
KKISREHTVMASKTGLVTVTGGKWTTYRAMSEDVLAECFQIGRLPSRPAGVTVNLPLVGA
PAEAAVTHSMNQSQGLHSYGTDAAAVAVLPGAQNWLMDGLSEAMVRFAARFEYARTVEDM
LARRSRLLFLDARKAAEIAPRVAAILTEELAQDVQLNDFLALTRQYLPAQG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtccactcaacccttggctacaacgcgcgcacaactgctggagcgtctggcg
cagaccgaaagcttcgatctggccatcgtgggcggcggtgccacggggctgggcgtggcg
gtggatgcggcggcacgcggcttcaaggtcgtgctgctggagtcgctggacttcgccaag
ggcacttcctcgcgtgccaccaagctggttcacggcggcgtgcgctatctggcgcagggc
aatatctccctggtgcgcgaagcactgcacgagcgcacgaccctgttgcacaatgcaccg
catctggcccagcctctggcctttgtgatgccctcgtacaagctgctggatacgccgttc
tacggcatcggcctcaagatgtacgacgcgctggccggcaaggccggcctgggggctacc
gaattcctctccagcgccaagaccgtgaaatacctgccgaccgtgcagcaaaaaggtctc
aagggcggggtcaagtactgggatggtcagtttgacgatgcgcgcctggcgctggcgctg
gcgcgtaccgcagcggccaagggcgctttgctgatcaattactgcccggcggaaaagctg
atctacgagggtcagcagattgccggcctgatctgccgcgatgcggaatccggccgcaac
ttcaccgtgcgcgccaagtgcgtggtcaatgccacgggaccctgggtggatctgttccgc
cagcaggatgccgaggcccagggcaagcccgtcaagcccatggtggcgcccagccagggc
gtgcacgtggtggtggatcgcgagttcctgcccacggatcatgcgctgctgatccccaag
acggccgatggtcgcgtgctgtttgccgtgccgtggctgggcaaggtcattttgggaacc
accgacacgccgcgtcacgatctggcgcgcgaacccctgcccttccccgaagagctggac
ttcattctcggcgaggccggcaaatatctgaatcgccagcccacgctggccgatgtgcgc
agcatgtgggtgggcctgcgccccctggtcaagccgcaggacgatgacggcgagaacacc
aagaagatcagccgcgagcacacggtgatggccagcaagaccggcctggtgaccgtcacc
ggcggcaaatggacgacgtaccgggccatgtccgaggatgtgctcgccgaatgcttccag
atcggtcgtctgcccagccgtcctgccggggtgaccgtgaacctgcccctggtcggtgcg
ccggccgaggcggccgtcacgcacagcatgaaccagagccaggggctgcactcctacggc
acggatgccgccgccgtggctgtgctgcctggtgcgcagaactggctgatggacggtctt
tccgaggccatggtgcgctttgccgcccgctttgaatacgcgcgcaccgtcgaggacatg
ctggcgcgccgcagtcgcctgcttttcctcgatgcccgcaaggctgccgagatcgcgccc
cgcgtggcggccatcctgaccgaggagctggcccaggatgtgcagctcaacgacttcctg
gccctgacccgccaatatctgcccgcccagggctga

DBGET integrated database retrieval system