KEGG   Cronobacter turicensis: CTU_04350
Entry
CTU_04350         CDS       T00999                                 

Gene name
gatD
Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00052  Galactose metabolism
ctu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CTU_04350 (gatD)
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     CTU_04350 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Methyltransf_25 UDPG_MGDP_dh_N TrkA_N Methyltransf_31 3HCDH_N Pyr_redox_2 MTS Shikimate_DH ELFV_dehydrog Met_10 XdhC_C Pyr_redox PrmA Peptidase_U32
Other DBs
NCBI-ProteinID: CBA27453
UniProt: C9XU52
LinkDB
Position
complement(479901..480959)
AA seq 352 aa
MSGGTMKSVVIHAEGSVRVEERPMPTINADDDVLVKVVCSGLCGSDIPRIFAGGAHYYPI
TLGHEFSGYVERCGSAVSDLSPGDAVACVPLQPCFVCEECARGYFSLCRHYQFVGSRSEG
GHAEYIVVRRASLFRLPPEMSVEDGAFLEPVTVGLHAFHQAQGCEGKNVVIVGAGTIGLL
AMQCAQALGANSVTAIDINPEKLRLALALGADRVLNSREMSAQAISAALETQRFDQLVLE
TAGTPQTVSLAIDIAGPRAQVALVGTLHHDLTLCATVFGKILRNELTLVGSWMNYSAPWP
GEEWRTAARLLAEKRLSLSPLIAHQGDAESFVSAVQALNGAPMQGKILLRFA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atttctggaggaacaatgaaatcagtggtaattcatgctgagggcagcgtacgcgttgaa
gaacgccctatgcccactatcaatgcggacgacgacgtcctggtgaaagtcgtttgttcg
ggtttatgcggctccgatatcccccgcattttcgccggcggcgcgcactactatcccatt
acgctgggccatgagtttagcggctatgtagagcgctgcggcagcgcggtaagcgatctt
tcgcccggcgatgcggtggcctgcgtgccgctacagccctgttttgtctgtgaagaatgc
gcgcgcggttacttttccctatgccgacactaccagtttgtcggctcccgcagcgaaggt
ggccacgccgagtatattgtggtcagacgcgccagcctctttcgattgccgccagagatg
tcggttgaagatggcgcgtttctcgaacctgttaccgtcgggctacatgcttttcaccag
gcccaggggtgtgaaggcaaaaacgtcgtgatcgtcggcgccggcactatcggtctgctg
gcgatgcagtgcgcgcaggcgctgggcgcgaatagcgtgacggccattgatattaatccc
gaaaagctccggctggcgctcgcgctcggcgccgatcgcgtgctgaacagtcgggaaatg
tccgcacaggccatttccgccgcgctggagacgcagcgcttcgatcaactggtgctggaa
accgcgggcacgccgcagacggtatcactggccatcgacatcgccgggccgcgcgcgcag
gtcgcgctggtggggacgctccatcacgaccttacgctctgcgccacggtttttggcaaa
attttacgtaatgaactgacgctggtcggcagctggatgaactattcggcgccctggccg
ggtgaagagtggcgaaccgccgcgcgactgcttgccgaaaagcggctgtcgctcagtccg
ctgattgcgcatcagggggatgcggaaagcttcgtcagcgccgtccaggcgctcaacggc
gcaccgatgcagggcaaaattctgctgcgcttcgcctga

DBGET integrated database retrieval system