KEGG   Cronobacter turicensis: CTU_12420Help
Entry
CTU_12420         CDS       T00999                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ctu  Cronobacter turicensis
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CTU_12420 (ahpF)
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CTU_12420 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored Thi4 FAD_binding_3 DAO NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: CBA29092
UniProt: C9XYN7
LinkDB All DBs
Position
1308904..1310469
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSAEIKELLLEIAELSDKVSFREDNTLAA
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGAVFQNEITDRNIMGVPAVFMNGVE
FGSGRMTLAEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKSHVDDYDVDVIDTQSATKLIPAASEG
GLHQIETASGAVLKARSVIVATGAKWRNMGVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILSAMTTEVKGD
GTKLTGLDYQDRVTGAVKHLEVAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaacatgaaaacccagctcaaggcctatcttgagcgtctgacaaaacct
gttgagttagtggccacgctggatgacagcgcgaaatcggcagagatcaaagagttgctg
ctggaaatcgccgagctgtctgacaaagtctctttccgtgaagacaacacgctggcggcg
cgcaaaccttcatttttgattaccaacccgggttctgaccaggggccgcgctttgcgggc
tctccgctgggccacgaatttacgtcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaagcgcaggcgctgctggagcagatccgcgatctggacggcgattttgag
tttgagacttactattcgctctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgttgaacccgcgtattaaacatacggcaattgatggggcggtgttccag
aatgaaatcaccgatcgcaacatcatgggcgtgccggccgtgttcatgaacggcgtggaa
tttggctcgggtcgtatgacgcttgcggaaatcgtcgcgaaagtggacaccggcgctgaa
aaacgcgcggcggaagagctgaatcagcgcgacgcttacgacgtgctgattgtcggctcc
ggcccggcgggcgcggcggcggcgatttactccgcccgtaaaggcatccgtaccggcctg
atgggcgagcgtttcggcggccaggtgctggacaccgttgatattgaaaactacatctct
gtgccgaaaaccgaaggccagaaactggcgggcgcgctgaaatcccacgtggatgattac
gacgttgacgttatcgacacccagagcgcgacgaagcttatcccggcggcaagcgaaggc
ggcctgcaccagattgaaacggcgtccggcgcggtgctgaaagcgcgcagcgtgatcgtg
gcgaccggcgcgaaatggcgcaacatgggcgtgcccggtgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgtgacggcccgctgtttaaaggcaaacgcgttgcggtg
ataggcggcggtaactccggcgtggaagcggccatcgacctcgcggggatcgttgagcac
gtgacgctgctggaattcgcgccggagatgaaagccgaccaggtattgcaggacaaactg
cgcagcctgaaaaacgtcgacatcatcctgagcgcgatgaccaccgaagtgaaaggcgac
ggcacgaagctgaccggccttgattatcaggatcgcgtgacgggcgctgtgaagcatctg
gaagtggcggggatctttgttcagattggtctgctgccgaacacgacctggcttgaaggc
gctatcgagcgtaaccgcatgggcgaaatcatcatcgacgccaaatgcgagaccagcgtg
aagggcgtgttcgccgcaggcgactgcaccaccgtgccgtacaaacagattattatcgcc
accggcgaaggcgcgaaagcctccctgagcgcgtttgattatctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system