KEGG   Cronobacter turicensis: CTU_16860Help
Entry
CTU_16860         CDS       T00999                                 

Gene name
nagZ
Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00520  Amino sugar and nucleotide sugar metabolism
ctu01100  Metabolic pathways
ctu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CTU_16860 (nagZ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CTU_16860 (nagZ)
Enzymes [BR:ctu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CTU_16860 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CBA29982
UniProt: C9Y1J6
LinkDB All DBs
Position
1778916..1779941
Genome map
AA seq 341 aa AA seqDB search
MGPVMLDVEGFELDAEEREILGHPLVGGLILFTRNYHDPEQLRELVRQIRASAHNHLVIA
VDQEGGRVQRFREGFTRLPAAQSFAALLGMDAGGKLAEEAGWLMACEMIAMDIDISFAPV
LDVGHLSAAIGERSFHDEPENVLAMAKRFISGMRSAGMKATGKHFPGHGAVSADSHKETP
RDPRPAADIRRHDMLPFRELISYNMLDAVMPAHVVYSDVDPLPASGSPYWLKQVLRKELG
FDGVIFSDDLSMEGAAILGSYAERGQAALDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TRLYHKGVITRQELMASARWKQVSGELTALHERWQTHKAGQ
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgggtccggtcatgctggatgtggaaggttttgagcttgatgccgaagagcgtgaaatt
ctggggcatccgctggtaggggggctcatactctttacccgcaactatcacgatccagag
cagttgcgtgaactggtccgccagatccgcgcgagcgcccacaatcacctggtgattgcg
gtggaccaggaaggcggccgcgtgcagcgttttcgcgagggctttacccgcctgcctgcg
gcgcaaagtttcgccgcgctgctgggaatggacgccggcggcaaactggcggaagaagct
ggctggctgatggcctgtgaaatgatcgcgatggatatcgatatcagttttgcgccggta
ctggatgtcggccatctcagcgctgcgattggcgagcgatctttccatgatgagccggag
aacgtgctggcgatggcgaagcgtttcatttcggggatgcggagcgcgggaatgaaagcg
accggtaaacacttccccggtcacggtgccgtgagcgccgattcccataaagagacgccg
cgcgacccgcgcccggccgcggacatccgtcgtcacgacatgctgccgtttcgcgagctt
attagttacaacatgctcgatgctgtaatgccggcgcacgtcgtctatagcgatgtcgat
ccgctgccggcgagcggttcgccttactggcttaagcaagtgctgcgtaaggagctcggt
tttgacggcgtaattttctctgacgatctgtctatggaaggggcggctattctcggcagc
tacgcggaacgcggtcaggcggcgctggatgccggttgcgatatgatccttgtctgtaat
aatcgtaagggtgccgtaagcgttcttgataacctgtcaccgatcaaagcagagcgtgtt
acacgtttgtatcataaaggtgtaattacgcgtcaggaactgatggcgtcggcgcgctgg
aagcaggtaagcggggagcttaccgcgctgcatgagcgctggcagacgcacaaggcgggg
caataa

DBGET integrated database retrieval system