KEGG   Cronobacter turicensis: CTU_19880Help
Entry
CTU_19880         CDS       T00999                                 

Gene name
sodC
Definition
(GenBank) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ctu  Cronobacter turicensis
Brite
Enzymes [BR:ctu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CTU_19880 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CBA30583
UniProt: C9Y3L6
LinkDB All DBs
Position
2087135..2087653
Genome map
AA seq 172 aa AA seqDB search
MKRLTLAAMALLTCGVVQAASQEVDLHLATDQGVGQSVGTVKITETDKGLEFAPDLKGLP
PGEHGFHIHANGSCEPAMKDGKMAAAEAAGGHFDPQKTGKHAGPEGDGHLGDLPALAVNN
DGKATEPVTAPRIKTLDEIKGKALMVHVSGDNMSDHPKPLGGGGARYACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattgactctggcggcgatggcgctgctgacatgcggcgtcgtacaggccgcc
agccaggaagtggacctgcatctggctaccgaccagggcgtcggccagtcggtcggtacg
gtcaaaatcactgaaaccgataaaggcctcgaattcgcgcccgatcttaaggggctgccg
ccaggcgagcacggttttcacatccacgccaacggtagctgcgagcccgccatgaaagac
ggcaaaatggcggcggcagaagcggcaggcggtcatttcgacccacaaaagaccggtaaa
cacgccgggcctgagggcgacgggcatttaggcgatctgccggcgctggccgtcaataat
gacggaaaagccaccgagccggtgaccgcgccgcgaattaaaacgcttgatgaaatcaaa
ggcaaagcgctgatggtgcatgtcagcggcgataacatgtccgatcatccgaaaccgctt
ggcggcggcggcgcccgttacgcctgcggcgttatttaa

DBGET integrated database retrieval system