KEGG   Cronobacter turicensis: CTU_19990Help
Entry
CTU_19990         CDS       T00999                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00480  Glutathione metabolism
ctu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CTU_19990 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctu02000]
    CTU_19990 (gst)
Enzymes [BR:ctu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CTU_19990 (gst)
Transporters [BR:ctu02000]
 Other transporters
  Pores ion channels [TC:1]
   CTU_19990 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: CBA30606
UniProt: C9Y3M7
LinkDB All DBs
Position
complement(2096902..2097510)
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREADIDFTLVAVDLAAKRTENGEDYLTINPKGQVPALLLDDN
TLLTEGVAIVQYIADKVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPGTPDE
YKTTAREQLQKKFEYVNEALAQKQWLMGLRFSVADAYLFTVLNWANAVGLEMQAFENIAD
YQARVKARPAVAAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggcgcgtgttcgctttcgccgcacatcattctgcgcgaa
gctgatatcgattttacgctggtggcggtggatttggccgcgaagcgcacggagaacggc
gaagactatctgactatcaacccgaaaggtcaggtgccggcgctgctgctggatgacaat
acgctgctgacagagggcgttgctatcgtacagtatatcgcggataaagtgccggaccgc
cagctgctggcgcctgtcggcagcatgacccgctaccatacgctggagtggctgaactat
atcgccacagagctgcacaagggctttacgcccctgttccgccccggtacgccggacgag
tacaaaactaccgcgcgcgagcagttgcagaagaagtttgagtatgtgaatgaggcgctg
gcgcagaaacagtggctgatggggctgcgcttcagcgtggcggatgcttacctgtttacc
gtgctgaactgggcgaacgcggttgggcttgagatgcaggcgtttgaaaatatcgccgac
taccaggcccgcgtgaaagcgcgtcctgccgtcgcggcggcgctgaaggcggaaggcctg
agcgcgtaa

DBGET integrated database retrieval system