KEGG   Cronobacter turicensis: CTU_29160Help
Entry
CTU_29160         CDS       T00999                                 

Gene name
yfbQ
Definition
(GenBank) Uncharacterized aminotransferase yfbQ
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ctu  Cronobacter turicensis
Pathway
ctu00220  Arginine biosynthesis
ctu00250  Alanine, aspartate and glutamate metabolism
ctu00290  Valine, leucine and isoleucine biosynthesis
ctu01100  Metabolic pathways
ctu01110  Biosynthesis of secondary metabolites
ctu01130  Biosynthesis of antibiotics
ctu01210  2-Oxocarboxylic acid metabolism
ctu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTU_29160 (yfbQ)
   00290 Valine, leucine and isoleucine biosynthesis
    CTU_29160 (yfbQ)
   00220 Arginine biosynthesis
    CTU_29160 (yfbQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctu01007]
    CTU_29160 (yfbQ)
Enzymes [BR:ctu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CTU_29160 (yfbQ)
    2.6.1.66  valine---pyruvate transaminase
     CTU_29160 (yfbQ)
Amino acid related enzymes [BR:ctu01007]
 Aminotransferase (transaminase)
  Class I
   CTU_29160 (yfbQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CBA32439
UniProt: C9XWR9
LinkDB All DBs
Position
3050518..3051732
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGQKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARDMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSGGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQHNLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINEIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPRIDELDLAINKLGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccatcgaaaaatccagtaagctcgacaatgtctgctacgacatccgcggcccg
gtgctaaaagaggccaaacgcctcgaagaggaaggtcaaaaagttcttaagctgaatatc
ggcaacccggcccctttcggctttgacgcgcctgatgaaattcttgtggatgtcatccgc
aatctgcctaccgcccagggctactgcgattccaaagggctctattccgcccgtaaagct
atcatgcagcactaccaggcgcgcgacatgcgcgacgtcacggttgaggatatttatatc
ggcaatggcgtttctgagcttatcgttcaggcgatgcaggcgttactgaacagtggtgat
gaaatgctggtgccggcgcccgactacccgctgtggacggcggcggtgtcactctccggc
ggcaaagcggtgcactatctttgtgatgaatcctcagactggttcccggatctcgacgac
attcgcgccaaaatcacgccgcgcacccgcggaattgtcattatcaacccgaacaacccg
accggcgcggtctattcgaaagaactgctgctggaaatcgttgagatcgcccgccagcat
aatctgatcattttcgcagacgaaatttacgacaagatcctctatgacgacgcccagcac
cactcgatcgcagcgctggcgccggatctgctcaccgtcacctttaacggcctctccaaa
acgtaccgtgtggcgggcttccgtcagggctggatggtgctgaacgggccgaaaaaacac
gccaaagggtatattgaagggctggaaatgcttgcttcaatgcgcctgtgcgcgaacgtt
cctgcgcagcacgccatccagacggcccttggcggttatcagagcatcagcgaatttatc
gtacccggcgggcggctttacgaacaacgcaaccgcgcgtgggaactgatcaacgaaatc
ccaggcgtcagctgcgtaaaaccgcgcggcgcgctctacatgttcccgaaaatcgacgca
aagcgttttaatattcacgacgatcagaaaatggtgctcgatttcctgctgcaggaaaaa
gtactgctggttcaggggaccgcgtttaactggccgtggcctgaccacgtacgtatcgtg
acgctgccgcgcatcgatgaactcgatctcgccattaacaagctgggccgcttcctttcc
ggctaccatcagtaa

DBGET integrated database retrieval system